KEGG   Advenella kashmirensis: TKWG_06205Help
Entry
TKWG_06205        CDS       T02117                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
aka  Advenella kashmirensis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:aka00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:aka00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1069494..1070171
Genome map
AA seq 225 aa AA seqDB search
MFNPQLNRHGELTHLLSTEGLPRDILTHILDTAQTFVPMAERDIKKVPLLRGKSVFNLFF
ENSTRTRTTFEIAAKRLSADVYNLNINVSSTAKGESLLDTISNLTAMQADIFVVRHEASG
APYLIARNVEPHIHVINAGDGRHAHPTQGLLDMYTIRHFKKDFSGLTVAIVGDILHSRVA
RSDIHALTTLAQPKCAPSVRSRCCRAGLNKWASRCSPICAKACGM
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacccgcaattgaaccggcatggcgagctgactcatctgctatctaccgagggg
ctgccgcgcgacattctgacccacatcctggacacggcccagacattcgtgcccatggct
gagcgcgacatcaaaaaggtgccgttgctgcgcggcaaaagcgtcttcaatctgtttttt
gagaactccacccgcacccgtaccacatttgaaatagccgccaaacggctctcggcggat
gtctataacctgaacatcaacgtatcgtctaccgccaaaggcgagtcgctgctcgatacc
atcagcaatctgacggccatgcaggccgatatttttgtcgtgcggcatgaagccagcggc
gccccttatcttattgcccgcaacgtcgagccccatatccacgttatcaatgccggggac
gggcgccatgcgcatcccacgcaaggcttgctggatatgtacaccatccgtcatttcaag
aaggatttttccggactgacggtggccatcgtgggcgatattttgcattcccgggtcgca
cggtccgacatacatgcactgaccacactggcgcagccgaagtgcgcgccatcggtccgc
tcacgctgctgccgggcgggcttgaacaaatgggcgtcaaggtgttcaccgatatgcgcg
aaggcctgcgggatgtag

DBGET integrated database retrieval system