KEGG   Advenella kashmirensis: TKWG_08430Help
Entry
TKWG_08430        CDS       T02117                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
aka  Advenella kashmirensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:aka00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TKWG_08430 (recR)
DNA repair and recombination proteins [BR:aka03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TKWG_08430 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1452913..1453524
Genome map
AA seq 203 aa AA seqDB search
MRDMLPEPEPLSALIDALRRLPGVGQRSARRMAYHLLQYDIAGADQLSRALSTAVNDIRH
CARCNSFSQNDICETCLNPKRNAAQLCIVETPADQNMIEASHGYQGLYYVLMGRIAPLEG
VGPAQLNFERLLRRAMDGTVAEVILATNFTAEGETTAHYLTEILREKGLQVSRIARGIPT
GSELEYVDAGTIAWAFMERRGAQ
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgacatgctgcctgaacccgagccattaagtgcattgatcgatgcgctgcgccgc
cttcccggcgtcggtcagcgctcggcaagacgcatggcttatcatttgctgcaatacgat
atagcgggtgctgaccagctgtcccgtgcactcagtactgccgtaaacgatattcgacat
tgtgctcgctgcaactcattttcccagaatgacatctgtgaaacctgtctgaatccgaaa
cgcaatgcggcacagttgtgcatagtcgagacgccggctgatcaaaatatgatagaggcc
agtcatggatatcaggggctgtattatgtgctcatggggagaattgcgccgcttgaaggc
gtgggaccggcacagctcaacttcgaacgactgctcaggcgtgcaatggatggcacggtc
gccgaagtcattctggcaaccaatttcaccgcggaaggggaaaccaccgcgcattacctg
actgaaattttgcgtgaaaaaggcttgcaggtctcacgcattgcgcgcggcatacctacc
ggcagcgagctggaatatgttgatgccggcaccattgcctgggcgtttatggagcgccgc
ggcgcacaataa

DBGET integrated database retrieval system