KEGG   Advenella kashmirensis: TKWG_08520Help
Entry
TKWG_08520        CDS       T02117                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
aka  Advenella kashmirensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aka00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TKWG_08520
Enzymes [BR:aka01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     TKWG_08520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1468815..1469417
Genome map
AA seq 200 aa AA seqDB search
MIHNLRDCGRPISVDTFKPAVMRAALAAGADLINDIYALRMPGALEVVAAHPNCGVCLMH
MQGEPKTMQAAPQYENVTDEVYRFLEERKAAAVAAGIAPARICLDPGYGFGKTVQQNYQL
LREQDRLSGLHSPLLIGLSRKTMIAAVTGRAPQDRVAGSIAGALAAANRGAAIIRVHDVA
QTADALKVWAATEQGEIHGA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
gtgatacataatctgcgtgattgtggcagacctatctccgtggacaccttcaaaccggca
gtgatgcgtgctgccctggcggcgggtgccgatctgatcaatgatatttatgccttgcgc
atgcccggcgcccttgaggttgtagcagcgcatcccaattgcggggtgtgcctgatgcat
atgcagggtgagcctaaaaccatgcaggctgcgcctcagtacgaaaatgtgactgacgag
gtctaccggtttctggaggaacgcaaggcggcggcggtggcggccggaattgcgcctgca
cgcatctgtctggatccgggatatggtttcggtaagacagtgcagcaaaattatcagctt
ttacgtgaacaggacaggctgtccggtttacactcaccgttattaatcggtctgtcccgt
aaaaccatgattgcagcggttacgggccgggctccgcaggaccgcgttgccggcagcatt
gccggcgcgctggctgctgcaaatcggggcgcggctatcatacgggtacacgatgtcgca
caaactgcagatgccctcaaagtgtgggcggccacagaacaaggagaaattcatggggcg
taa

DBGET integrated database retrieval system