KEGG   Advenella kashmirensis: TKWG_09265Help
Entry
TKWG_09265        CDS       T02117                                 

Definition
AMP-dependent synthetase/ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aka  Advenella kashmirensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aka00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TKWG_09265
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TKWG_09265
   00620 Pyruvate metabolism
    TKWG_09265
   00640 Propanoate metabolism
    TKWG_09265
  Energy metabolism
   00680 Methane metabolism
    TKWG_09265
Enzymes [BR:aka01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TKWG_09265
Lipid biosynthesis proteins [BR:aka01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TKWG_09265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1606976..1608961
Genome map
AA seq 661 aa AA seqDB search
MHKHFGIGFGMSDQRFVWYPPMETIQASNIAKFLHLADVDDYDELLKKAEKNPEWFWKLI
IDRVTFSKPYSTLLDLSGGVQFPRWCVGGEGNIVLDCLDRHQGTSTWSKEFLVWEAESGE
VVRWTYADLHREVCRVARSLDRLAITVGDVVGLFLPNIPHAIAAFLACAKKGVIALPLFS
GFGSNALKDRLEAAGAIAVITADGTSRRGMGISMKAVADEAVETLGELKHVIVVRNADID
VVWNSGRDHWLDDLVGDESIECSTVHLAADAPLMLMYTSGTSGKPKGTVHTHLGFATKML
LDVGLVMDLKATDRMLWMSDMGWLVGPIVAAAVPLHGASVVLAEGGPDYPDEDRMWRLID
DHTVTFLGLAPTLARSFIRNDGSQIEKYSLTSLRVCVSTGEVWTPEAWLWTFENVCKKKI
PLLNYSGGTEIGGGILCGTVIHPIKPCAFTRPIPGMGARIFDESGKQVLRGEVGELVLTS
PSPGRTRSLWRSDDTYLDAYWSTYPGVWRHGDWAVEDSDGWWEITGRSDDILKIAGKRTG
PSEIEALIAGTGLVVESAVIGLPDPVKGQAVVCVVTVKRGVVADKVTQNALVRAVVKGLG
PPFKPQAIIFVDELPKTRNMKVMRRLVRAACLGHEPGDLSALVNPDAFGLLRDAAATANL
K
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgcataaacacttcggaatcggattcggtatgagtgatcagcgcttcgtgtggtacccg
ccaatggagactattcaggccagcaatatcgcgaagtttctgcatctcgctgatgttgat
gactacgacgagcttcttaaaaaggctgagaaaaaccctgaatggttctggaagttgatt
attgatcgagtgacgttctcaaaaccctacagtaccctgcttgatctttctggcggtgtc
caattcccacggtggtgcgttggaggagagggaaacatagtgttggactgtcttgaccgt
catcaaggcactagtacctggtcgaaagagttcctggtgtgggaggccgaaagtggagag
gtggtccggtggacatatgctgatttgcaccgagaagtttgccgggtcgcaaggtcccta
gaccggttggctattacggtgggtgatgttgtcgggctttttttgccgaacattcctcat
gctatcgcggcttttcttgcttgtgccaagaagggagttattgcactcccccttttttcg
ggatttgggtcgaacgcactaaaagaccggttagaagccgcgggagctattgctgttatc
acggctgacgggacatctcgacgtggcatgggaatctccatgaaggcggtcgcagacgag
gcagtcgaaacgctcggcgagctcaagcatgtcattgtcgtcaggaacgccgatatagat
gtcgtatggaatagtggtcgtgatcattggctggacgatttggtcggtgatgagagcatt
gagtgttccacggtacatttggcagccgacgctccgctaatgctcatgtatacatccggc
acttccggaaagccgaaaggtacagtgcatacccatctcgggtttgcaacgaaaatgctt
ttagatgtcggactggtcatggacctaaaagccaccgacagaatgctgtggatgagcgac
atgggatggctcgtgggtccgatagttgccgccgccgtcccgctccacggagcctctgtg
gttctggcggaaggtggtccggattatccagacgaggatcggatgtggcgtctgatcgat
gatcacacagtaaccttcctgggactggcaccaacattggcgagaagtttcatacgtaac
gacggaagtcagatcgaaaaatattctctgactagtttgagggtgtgtgtttctacagga
gaggtctggacgccagaagcatggctttggacttttgagaacgtgtgcaagaaaaaaatt
ccgttgctcaattattctggcggcaccgagattggaggtggaattctttgtggcacggta
attcacccaattaagccctgcgcctttactcggcctatccccggcatgggtgcacgcata
ttcgatgaaagcggtaagcaagtgctacgaggtgaagtaggtgagctcgttctaacgtca
ccgtcaccaggaaggacacgaagcctatggcgcagcgacgatacctatttagatgcctac
tggtcaacgtaccctggcgtatggcgccatggagactgggcagtggaagactccgatggc
tggtgggaaattacgggcaggtccgacgatatattgaaaattgcaggaaagcggacaggg
ccatccgaaattgaggctttaattgccggcaccggacttgtggttgagtcagcggtgata
gggctgcccgatccggttaaggggcaagctgtcgtctgtgttgtaactgttaaacggggt
gttgtcgccgacaaggttacacagaacgcgcttgttcgggctgtagtcaaaggcttgggt
cctccgttcaagcctcaagccattatcttcgtggatgagcttccgaaaacgcgcaatatg
aaagtcatgcgtcgtttggttcgcgctgcatgcctgggacatgaaccaggtgacctttct
gctcttgtgaatcctgatgctttcggattgcttcgcgacgcagcggcaacggcaaactta
aaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system