KEGG   Advenella kashmirensis: TKWG_09265Help
Entry
TKWG_09265        CDS       T02117                                 

Definition
(GenBank) AMP-dependent synthetase/ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aka  Advenella kashmirensis
Pathway
aka00010  Glycolysis / Gluconeogenesis
aka00620  Pyruvate metabolism
aka00640  Propanoate metabolism
aka00680  Methane metabolism
aka01100  Metabolic pathways
aka01110  Biosynthesis of secondary metabolites
aka01120  Microbial metabolism in diverse environments
aka01130  Biosynthesis of antibiotics
aka01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aka00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TKWG_09265
   00620 Pyruvate metabolism
    TKWG_09265
   00640 Propanoate metabolism
    TKWG_09265
  Energy metabolism
   00680 Methane metabolism
    TKWG_09265
Enzymes [BR:aka01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TKWG_09265
Lipid biosynthesis proteins [BR:aka01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TKWG_09265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N DUF4173
Motif
Other DBs
NCBI-ProteinID: AFK62179
UniProt: I3UAZ1
Position
1606976..1608961
Genome map
AA seq 661 aa AA seqDB search
MHKHFGIGFGMSDQRFVWYPPMETIQASNIAKFLHLADVDDYDELLKKAEKNPEWFWKLI
IDRVTFSKPYSTLLDLSGGVQFPRWCVGGEGNIVLDCLDRHQGTSTWSKEFLVWEAESGE
VVRWTYADLHREVCRVARSLDRLAITVGDVVGLFLPNIPHAIAAFLACAKKGVIALPLFS
GFGSNALKDRLEAAGAIAVITADGTSRRGMGISMKAVADEAVETLGELKHVIVVRNADID
VVWNSGRDHWLDDLVGDESIECSTVHLAADAPLMLMYTSGTSGKPKGTVHTHLGFATKML
LDVGLVMDLKATDRMLWMSDMGWLVGPIVAAAVPLHGASVVLAEGGPDYPDEDRMWRLID
DHTVTFLGLAPTLARSFIRNDGSQIEKYSLTSLRVCVSTGEVWTPEAWLWTFENVCKKKI
PLLNYSGGTEIGGGILCGTVIHPIKPCAFTRPIPGMGARIFDESGKQVLRGEVGELVLTS
PSPGRTRSLWRSDDTYLDAYWSTYPGVWRHGDWAVEDSDGWWEITGRSDDILKIAGKRTG
PSEIEALIAGTGLVVESAVIGLPDPVKGQAVVCVVTVKRGVVADKVTQNALVRAVVKGLG
PPFKPQAIIFVDELPKTRNMKVMRRLVRAACLGHEPGDLSALVNPDAFGLLRDAAATANL
K
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgcataaacacttcggaatcggattcggtatgagtgatcagcgcttcgtgtggtacccg
ccaatggagactattcaggccagcaatatcgcgaagtttctgcatctcgctgatgttgat
gactacgacgagcttcttaaaaaggctgagaaaaaccctgaatggttctggaagttgatt
attgatcgagtgacgttctcaaaaccctacagtaccctgcttgatctttctggcggtgtc
caattcccacggtggtgcgttggaggagagggaaacatagtgttggactgtcttgaccgt
catcaaggcactagtacctggtcgaaagagttcctggtgtgggaggccgaaagtggagag
gtggtccggtggacatatgctgatttgcaccgagaagtttgccgggtcgcaaggtcccta
gaccggttggctattacggtgggtgatgttgtcgggctttttttgccgaacattcctcat
gctatcgcggcttttcttgcttgtgccaagaagggagttattgcactcccccttttttcg
ggatttgggtcgaacgcactaaaagaccggttagaagccgcgggagctattgctgttatc
acggctgacgggacatctcgacgtggcatgggaatctccatgaaggcggtcgcagacgag
gcagtcgaaacgctcggcgagctcaagcatgtcattgtcgtcaggaacgccgatatagat
gtcgtatggaatagtggtcgtgatcattggctggacgatttggtcggtgatgagagcatt
gagtgttccacggtacatttggcagccgacgctccgctaatgctcatgtatacatccggc
acttccggaaagccgaaaggtacagtgcatacccatctcgggtttgcaacgaaaatgctt
ttagatgtcggactggtcatggacctaaaagccaccgacagaatgctgtggatgagcgac
atgggatggctcgtgggtccgatagttgccgccgccgtcccgctccacggagcctctgtg
gttctggcggaaggtggtccggattatccagacgaggatcggatgtggcgtctgatcgat
gatcacacagtaaccttcctgggactggcaccaacattggcgagaagtttcatacgtaac
gacggaagtcagatcgaaaaatattctctgactagtttgagggtgtgtgtttctacagga
gaggtctggacgccagaagcatggctttggacttttgagaacgtgtgcaagaaaaaaatt
ccgttgctcaattattctggcggcaccgagattggaggtggaattctttgtggcacggta
attcacccaattaagccctgcgcctttactcggcctatccccggcatgggtgcacgcata
ttcgatgaaagcggtaagcaagtgctacgaggtgaagtaggtgagctcgttctaacgtca
ccgtcaccaggaaggacacgaagcctatggcgcagcgacgatacctatttagatgcctac
tggtcaacgtaccctggcgtatggcgccatggagactgggcagtggaagactccgatggc
tggtgggaaattacgggcaggtccgacgatatattgaaaattgcaggaaagcggacaggg
ccatccgaaattgaggctttaattgccggcaccggacttgtggttgagtcagcggtgata
gggctgcccgatccggttaaggggcaagctgtcgtctgtgttgtaactgttaaacggggt
gttgtcgccgacaaggttacacagaacgcgcttgttcgggctgtagtcaaaggcttgggt
cctccgttcaagcctcaagccattatcttcgtggatgagcttccgaaaacgcgcaatatg
aaagtcatgcgtcgtttggttcgcgctgcatgcctgggacatgaaccaggtgacctttct
gctcttgtgaatcctgatgctttcggattgcttcgcgacgcagcggcaacggcaaactta
aaatga

DBGET integrated database retrieval system