KEGG   Advenella kashmirensis: TKWG_09265Help
Entry
TKWG_09265        CDS       T02117                                 

Definition
AMP-dependent synthetase/ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aka  Advenella kashmirensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:aka01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aka00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:aka00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:aka00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:aka00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1606976..1608961
Genome map
AA seq 661 aa AA seqDB search
MHKHFGIGFGMSDQRFVWYPPMETIQASNIAKFLHLADVDDYDELLKKAEKNPEWFWKLI
IDRVTFSKPYSTLLDLSGGVQFPRWCVGGEGNIVLDCLDRHQGTSTWSKEFLVWEAESGE
VVRWTYADLHREVCRVARSLDRLAITVGDVVGLFLPNIPHAIAAFLACAKKGVIALPLFS
GFGSNALKDRLEAAGAIAVITADGTSRRGMGISMKAVADEAVETLGELKHVIVVRNADID
VVWNSGRDHWLDDLVGDESIECSTVHLAADAPLMLMYTSGTSGKPKGTVHTHLGFATKML
LDVGLVMDLKATDRMLWMSDMGWLVGPIVAAAVPLHGASVVLAEGGPDYPDEDRMWRLID
DHTVTFLGLAPTLARSFIRNDGSQIEKYSLTSLRVCVSTGEVWTPEAWLWTFENVCKKKI
PLLNYSGGTEIGGGILCGTVIHPIKPCAFTRPIPGMGARIFDESGKQVLRGEVGELVLTS
PSPGRTRSLWRSDDTYLDAYWSTYPGVWRHGDWAVEDSDGWWEITGRSDDILKIAGKRTG
PSEIEALIAGTGLVVESAVIGLPDPVKGQAVVCVVTVKRGVVADKVTQNALVRAVVKGLG
PPFKPQAIIFVDELPKTRNMKVMRRLVRAACLGHEPGDLSALVNPDAFGLLRDAAATANL
K
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgcataaacacttcggaatcggattcggtatgagtgatcagcgcttcgtgtggtacccg
ccaatggagactattcaggccagcaatatcgcgaagtttctgcatctcgctgatgttgat
gactacgacgagcttcttaaaaaggctgagaaaaaccctgaatggttctggaagttgatt
attgatcgagtgacgttctcaaaaccctacagtaccctgcttgatctttctggcggtgtc
caattcccacggtggtgcgttggaggagagggaaacatagtgttggactgtcttgaccgt
catcaaggcactagtacctggtcgaaagagttcctggtgtgggaggccgaaagtggagag
gtggtccggtggacatatgctgatttgcaccgagaagtttgccgggtcgcaaggtcccta
gaccggttggctattacggtgggtgatgttgtcgggctttttttgccgaacattcctcat
gctatcgcggcttttcttgcttgtgccaagaagggagttattgcactcccccttttttcg
ggatttgggtcgaacgcactaaaagaccggttagaagccgcgggagctattgctgttatc
acggctgacgggacatctcgacgtggcatgggaatctccatgaaggcggtcgcagacgag
gcagtcgaaacgctcggcgagctcaagcatgtcattgtcgtcaggaacgccgatatagat
gtcgtatggaatagtggtcgtgatcattggctggacgatttggtcggtgatgagagcatt
gagtgttccacggtacatttggcagccgacgctccgctaatgctcatgtatacatccggc
acttccggaaagccgaaaggtacagtgcatacccatctcgggtttgcaacgaaaatgctt
ttagatgtcggactggtcatggacctaaaagccaccgacagaatgctgtggatgagcgac
atgggatggctcgtgggtccgatagttgccgccgccgtcccgctccacggagcctctgtg
gttctggcggaaggtggtccggattatccagacgaggatcggatgtggcgtctgatcgat
gatcacacagtaaccttcctgggactggcaccaacattggcgagaagtttcatacgtaac
gacggaagtcagatcgaaaaatattctctgactagtttgagggtgtgtgtttctacagga
gaggtctggacgccagaagcatggctttggacttttgagaacgtgtgcaagaaaaaaatt
ccgttgctcaattattctggcggcaccgagattggaggtggaattctttgtggcacggta
attcacccaattaagccctgcgcctttactcggcctatccccggcatgggtgcacgcata
ttcgatgaaagcggtaagcaagtgctacgaggtgaagtaggtgagctcgttctaacgtca
ccgtcaccaggaaggacacgaagcctatggcgcagcgacgatacctatttagatgcctac
tggtcaacgtaccctggcgtatggcgccatggagactgggcagtggaagactccgatggc
tggtgggaaattacgggcaggtccgacgatatattgaaaattgcaggaaagcggacaggg
ccatccgaaattgaggctttaattgccggcaccggacttgtggttgagtcagcggtgata
gggctgcccgatccggttaaggggcaagctgtcgtctgtgttgtaactgttaaacggggt
gttgtcgccgacaaggttacacagaacgcgcttgttcgggctgtagtcaaaggcttgggt
cctccgttcaagcctcaagccattatcttcgtggatgagcttccgaaaacgcgcaatatg
aaagtcatgcgtcgtttggttcgcgctgcatgcctgggacatgaaccaggtgacctttct
gctcttgtgaatcctgatgctttcggattgcttcgcgacgcagcggcaacggcaaactta
aaatga

DBGET integrated database retrieval system