KEGG   Advenella kashmirensis: TKWG_09355Help
Entry
TKWG_09355        CDS       T02117                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aka  Advenella kashmirensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aka00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TKWG_09355 (tpiA)
   01230 Biosynthesis of amino acids
    TKWG_09355 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TKWG_09355 (tpiA)
   00051 Fructose and mannose metabolism
    TKWG_09355 (tpiA)
   00562 Inositol phosphate metabolism
    TKWG_09355 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TKWG_09355 (tpiA)
Enzymes [BR:aka01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TKWG_09355 (tpiA)
Exosome [BR:aka04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TKWG_09355 (tpiA)
  Exosomal proteins of bladder cancer cells
   TKWG_09355 (tpiA)
  Exosomal proteins of melanoma cells
   TKWG_09355 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1626063..1626815
Genome map
AA seq 250 aa AA seqDB search
MSVRRRLVIGNWKMNGSKAENQQLLSDLVKLQNAAAANEAAAELAVCAPFPYLQQVADTL
KDSAIGWGGQDASEHAKGAYTGEVSVAMLAEFGCAWVIVGHSERRAYHGETSDVVARKAA
AAIAGGIAPVVCIGETQAEREAGNTLRVISSQLEPVLALGAEAVSKMVLAYEPVWAIGTG
LTASPEQAQEVHAHIRSLLVQAGAPEQRVLYGGSVKAANAASLFAKEDIDGALVGGASLV
ATDFQGIANA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgcgtcggcgtctggtcatcggaaactggaaaatgaatggcagcaaggctgaa
aaccagcaactgctttcggatctggtcaaattgcagaatgccgctgcggctaatgaggct
gcagcagagctggccgtatgcgcgccttttccttacctgcaacaagtggcagataccctg
aaggatagtgctatcggttggggtggtcaggatgccagtgaacatgccaagggcgcctat
accggtgaagtgtcggttgccatgcttgcggagttcggttgcgcctgggttattgtgggt
cattccgagcgccgcgcttatcatggtgaaaccagcgatgttgttgcacgcaaggctgcg
gctgcaattgccggcggtattgcgcctgtcgtatgcattggcgaaacacaagccgagcgc
gaggcgggcaatacactgcgggtaatcagcagccagcttgaaccagtccttgcgttgggc
gcggaagcggtcagtaagatggttctcgcatacgagccggtatgggctattggcacgggc
cttactgcctcgccagagcaggctcaggaagtgcatgcgcatattcgcagcttgctggtt
caagcgggtgcgcccgaacagcgcgttttgtatggcggcagcgtcaaggcggcaaatgca
gcaagcctgttcgccaaggaagatattgatggcgcgctggtaggcggcgcctcgctggtc
gcaacagattttcagggaattgccaacgcctag

DBGET integrated database retrieval system