KEGG   Advenella kashmirensis: TKWG_09710Help
Entry
TKWG_09710        CDS       T02117                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aka  Advenella kashmirensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aka00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TKWG_09710
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TKWG_09710
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TKWG_09710
Enzymes [BR:aka01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TKWG_09710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1691013..1692212
Genome map
AA seq 399 aa AA seqDB search
MTAYSFPDNRGHFGRYGGIFVAETLMHAVSELNEAYEKYKADPDFVAEYRYELAHFVGRP
SPVYHARRWSEQLGGAQIWFKREDLNHTGAHKINNCIGQILLARKMGKKRIIAETGAGQH
GVATATVAARYGMECVIYMGAEDVRRQASNVYRMKLLGATVVPVESGSRTLKDALNEAMR
DWVARIDDTYYIIGTVAGPHPYPAMVRDFQQIIGQECIEQMPACAGRQPDAVIACVGGGS
NAMGIFYPYLSHTKVKLIGVEAAGEGLDTPRHAASINGGKVGVLHGNRTYVLQNSDGQIQ
ETHSVSAGLDYPGVGPEHAWLHDSKRATYVAVDDNAALDAFGKCCQLEGIMPALESAHAL
AYAATLAPTLSRDAILLVCLSGRGDKDMHTVAEYTGIAL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
ttgactgcttattcctttcccgacaacaggggccatttcggccgttacggtggcattttt
gtcgccgaaacgctgatgcacgctgtttcggaactgaatgaagcctatgaaaagtacaag
gcagacccggattttgtcgccgagtaccggtacgaactggcgcattttgtcgggcgtccc
agcccggtctatcatgcccgccgctggtctgaacaactgggcggggcgcaaatttggttc
aagcgtgaagacctgaatcacaccggtgcgcacaagatcaacaattgcattggacaaatc
ctgctggcgcgcaaaatgggcaaaaagcgcattattgccgaaaccggcgcgggccagcat
ggcgttgcgaccgcgacggtggccgcgcgctatggcatggaatgcgtgatctatatgggc
gccgaagacgtgcggcggcaggcgtcaaatgtgtatcgcatgaagttgctgggggcgacg
gtggtgccggtggaatccggatcgcgtacgctcaaagatgccctgaacgaagccatgcgc
gactgggtcgcccgcattgacgacacctattacattatcggcaccgttgccggtcctcat
ccctatccggccatggtgcgcgatttccagcaaatcattggccaggaatgcatagagcag
atgcctgcctgtgccggtcgccagccggatgcagtcatcgcctgtgtcggtggcggctcc
aatgcaatgggcattttctatccttatctgtcgcataccaaggtcaagctaattggtgtt
gaagcagcgggcgagggcctggataccccccgtcacgcagcctccatcaacggcggcaaa
gtgggcgtcttgcatggcaatcgcacttacgtactgcaaaatagcgatgggcagattcag
gaaacccattctgtatcggccggactcgattaccccggtgtcggaccggaacacgcctgg
ctgcacgacagtaaacgcgccacctatgtggcggtagatgacaatgccgccctggacgcg
tttggcaaatgttgccaactggaaggcattatgccggccctggagtcggcacatgcgctg
gcctacgcagccacactggctcccaccctgtcacgcgacgccattttgctggtgtgcctg
tccggtcgcggcgacaaggatatgcataccgttgccgaatataccggcattgcgttgtaa

DBGET integrated database retrieval system