KEGG   Advenella kashmirensis: TKWG_11265Help
Entry
TKWG_11265        CDS       T02117                                 

Definition
esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
aka  Advenella kashmirensis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:aka00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    TKWG_11265
Enzymes [BR:aka01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     TKWG_11265
   3.1.2  Thioester hydrolases
    3.1.2.-  
     TKWG_11265
Lipid biosynthesis proteins [BR:aka01004]
 Fatty acid synthase
  Component type
   TKWG_11265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1954054..1954710)
Genome map
AA seq 218 aa AA seqDB search
MIRVLSILISLWVFVWPQATKAQEKPVSANAPVILVVGDSLSAEYGIRRGAGWVQWLAEN
KKEALGNAKLVNASISGDTTAGGRSRLPALLKKHQPAIMILELGANDALRGLSLEASRDN
LQNMIDSAQAVKAEVVLIGMQIPPNFGPDYARQFQQMFGALAKEKDTYLVPFLFASFALQ
RDMYQDDGIHPAEQAQPLMAQTVWPVLEKALTDYRQRR
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtgttctgtccattctgataagtctgtgggtgtttgtctggccgcaggcgacc
aaagcccaggaaaaaccggtatcggccaacgcacccgtcattctggtcgtgggtgatagc
ctgtctgccgaatatggtatcagacgcggtgctggctgggtgcagtggctggcggagaat
aaaaaagaagcgctgggcaatgcaaaactggtcaatgccagtatcagtggcgataccacc
gcaggaggacgcagccgcctgcccgcactactgaaaaaacatcaacctgccatcatgata
ctggaactgggcgccaatgatgcgttgcgcggcctttcgcttgaagccagccgtgacaat
ctgcaaaacatgatcgatagcgcccaggccgtcaaggccgaagtggtgctgatcggtatg
cagattccgcccaatttcgggcctgattacgcccgccagttccagcagatgttcggtgcg
ctggcaaaagaaaaggacacctatctggtgccctttctgtttgcttcatttgccctgcaa
cgggatatgtaccaggatgatggcattcacccggctgaacaggcccaaccgctaatggct
caaacggtttggcccgtgctggaaaaagcgcttactgattaccggcagcgtcgttaa

DBGET integrated database retrieval system