KEGG   Advenella kashmirensis: TKWG_11295Help
Entry
TKWG_11295        CDS       T02117                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
aka  Advenella kashmirensis
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:aka00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1957996..1958604)
Genome map
AA seq 202 aa AA seqDB search
MIIAPSGAGKSSLVNALLAQDNNISLSISCTTRDPRPGEQEGREYYFTTKQDFLQLRESG
QLLEWAEVHGNFYGTPRPPIEKAIAQGKDILLEIDWQGARQVRQHFPGVTGIFILPPSIE
VLETRLTQRGQDSASVITRRILAAGSEIAHAPECEYVIINEDFATALNELQKIVAAARLR
YQSQAARHAQLFSQLGISDSVR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgattatcgcacccagcggtgcgggcaaatcaagtctggtcaatgcgctgcttgcccag
gacaacaacatttccctgtccatttcctgcaccacgcgcgatccacgccctggcgagcag
gaaggccgcgaatactatttcactaccaaacaagactttctgcaattgcgcgagagcggg
caattgcttgaatgggccgaggtccatggcaatttttatggcacgccacgaccgcctata
gaaaaagccatcgcccagggcaaggacattcttctggaaatcgactggcaaggcgcgcgc
caggtccgtcagcatttcccgggcgtaacgggtatttttatcctgcccccatccatcgag
gtgctggaaacccggctgacccagcgcggacaggattcggccagcgtcatcacccgccgg
atactggcggcaggaagcgagatcgcgcacgctcccgagtgcgaatatgttattatcaat
gaagattttgccacagccctgaatgaattacagaaaatcgttgcagccgccaggctccga
taccagtctcaggccgcccggcatgcccaactcttctcccagctcggaatttccgattcc
gttcggtaa

DBGET integrated database retrieval system