KEGG   Advenella kashmirensis: TKWG_11615Help
Entry
TKWG_11615        CDS       T02117                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
aka  Advenella kashmirensis
Pathway
aka00900  Terpenoid backbone biosynthesis
aka01100  Metabolic pathways
aka01110  Biosynthesis of secondary metabolites
aka01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aka00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TKWG_11615
Enzymes [BR:aka01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     TKWG_11615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C FAD_binding_2 Semialdhyde_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AFK62525
UniProt: I3UBY7
Position
2018474..2019646
Genome map
AA seq 390 aa AA seqDB search
MQNITIFGATGSIGDSTLDIVRRHPDRFSVYALSAQRRMQKLAQLALEFSAKVVIVPDVD
AVDAFREHWPAQRLLPEIRMGERGLCETARDPETDCVVAAIVGIAGLASAFEAAQAGKRI
LLANKEALVAAGSLFMHTVQTHNAQLLPVDSEHNAIFQCLQNGREKQQIQRLILTASGGP
FRDTAISELDHVTPEQACRHPNWSMGQKISVDSATMLNKGLEVIEAHFLFGLAPDKIDVV
IHPESTVHSMVEFIDGSLLAQLGNTDMRIPISYVMGYPERIESNTPAFDLRKLQQLNFSL
PDFARFPCLKLAFDALHAGQAECIALNAANEIAVAHFLRGGLRFTQIAAVIERALDWQSG
QSSSIGHIDDVFQLDLLIRERASAFLPASV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatattacgattttcggagcaaccggctcgattggcgacagtacccttgatatt
gtgcgccggcatccagaccgattcagcgtgtatgcgctcagtgcccagcgacgcatgcag
aaactggctcagcttgcgttagagttttcggccaaagtggtcattgttcctgacgtcgac
gctgtagatgcgtttcgtgagcactggcctgcccagcggctgctgcctgaaatcaggatg
ggtgaacgcggcttgtgtgaaactgccagggatcccgaaacagattgtgtagtagcggcc
attgtgggaatcgctggcctggcttcggcgttcgaagcggcgcaggcgggcaagcgtatt
ttgctggccaacaaagaagcgctggttgctgcaggttcactatttatgcacacagtgcaa
acccataacgcgcaattattgccggtcgatagcgaacacaatgccatttttcaatgcctg
caaaatggcagggaaaagcagcaaatacaacggttgattcttactgcttcgggcggccca
tttcgtgatacagccattagcgaactggaccatgtaacgccagaacaggcttgccgtcat
ccgaactggagtatgggacagaagatttccgtggattcggcaacgatgctcaataaaggc
ctggaggtgatcgaggcgcactttctgttcggcctggcgcccgacaagattgatgtggtc
attcatccagagagcacggtgcactccatggtcgagtttattgacggttcgctgctggcg
cagttgggcaacacggatatgcgtattccgatttcctatgtcatgggataccctgagcgc
attgaaagcaatacgcctgcctttgatctgcgcaagctgcagcagctgaatttctcgctc
cccgattttgcacgatttccctgtctgaagctggcctttgacgcgttgcacgcagggcag
gccgagtgcattgccctgaatgccgcaaacgaaatcgccgtcgcccattttctgcggggc
ggcttgcgtttcacccaaattgcagctgtgattgagcgggcgctggactggcaaagcggc
cagagcagctcgatcggccacattgatgatgttttccagcttgacctcctgatacgcgaa
cgcgccagtgcgtttttacctgcttcggtttga

DBGET integrated database retrieval system