KEGG   Advenella kashmirensis: TKWG_11795Help
Entry
TKWG_11795        CDS       T02117                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
aka  Advenella kashmirensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:aka00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    TKWG_11795
  Metabolism of other amino acids
   00480 Glutathione metabolism
    TKWG_11795
Enzymes [BR:aka01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     TKWG_11795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2048261..2048743)
Genome map
AA seq 160 aa AA seqDB search
MSDFYSMNVTLQDGSQLPLSSLRDKVVLVVNVASRCGFTPQYTGLQRLHEQYRDQGLVVL
AFPCNQFGSQEPGTDQEIQDFCELNFGVTFALARKTEVNGPHTHPVFAWLKKEKPGLLGI
QSIKWNFTKFLVGRDGQVRHRYAPTVKPQDIEQDIKEALK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatttttattcaatgaacgtcacgttgcaagacggcagccaattgcctctgtcg
tccttgcgcgacaaagtcgtgctggtggtcaatgtcgcttccagatgcggctttacgccg
caatataccggcctgcagcgtctacatgaacagtaccgcgaccaaggcctggtggtactg
gcttttccctgcaatcagttcggcagccaggaacccggcaccgaccaggaaatccaggat
ttctgtgagcttaattttggcgtgacatttgcgcttgcccgcaagaccgaggtcaacggg
ccacacacgcatccggtctttgcatggcttaagaaagaaaaaccgggactgctgggtata
caatcgatcaaatggaatttcacaaaatttcttgttggtcgcgacggtcaagtacgacat
cgttacgcaccaacggtaaaaccgcaggacattgaacaggatatcaaggaagcattgaaa
tga

DBGET integrated database retrieval system