KEGG   Advenella kashmirensis: TKWG_14270Help
Entry
TKWG_14270        CDS       T02117                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
aka  Advenella kashmirensis
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aka00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TKWG_14270
  Amino acid metabolism
   00300 Lysine biosynthesis
    TKWG_14270
Enzymes [BR:aka01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     TKWG_14270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2470249..2471391
Genome map
AA seq 380 aa AA seqDB search
MSDAISSPVLALTQTLIARQSVTPDDRDCQQTLAAELADSGFVAEHLPFEEVQNLWLRRN
TASPLLIFAGHTDVVPTGPLEQWDSDPFVPTIRDGKLYGRGAADMKSSIAAFTVAAKAFV
QAHPEHRGSIAMLITSDEEGPSVNGTVKVCEYLKQQGVQPDYCIVGEPTSTAVLGDVIKN
GRRGSLSGKVVVKGLQGHVAYPHLARNPIHLCAPALHELASTEWDQGNEYFPPTTFQISN
FHAGTGATNVVPGSAQFLFNIRFSTASTVESLKSRVQAILDAHQLDSSIEWTLGGEPFLT
PRGELSEALSAAIKDVTGVQTALSTTGGTSDGRFIAKICPQVIEFGPINATIHQINEHIE
VDSLEPLAAIYRKTLENLLL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatgcaatttcttcaccggtgctggccctgacacaaacgctgatcgcccgccag
tcggtcacgccagacgaccgggattgccagcagacgctggccgctgaactggccgattcg
ggctttgttgcagagcatctgcctttcgaagaagtgcaaaacctctggctgcgacgcaac
accgcgtcgccgctgcttatttttgccggtcatacggatgtggtccccactggtccgctg
gaacagtgggacagcgatccttttgtacccacgattcgcgacggcaagctgtatggccgt
ggtgctgctgatatgaaaagctccatcgccgcgtttactgttgccgccaaagcgttcgtg
caggcgcatcccgagcatcggggttccatcgccatgctgatcacctcagacgaagaaggc
ccctccgtcaatggtaccgtcaaggtatgcgaatacctgaagcaacagggcgtgcagccg
gattactgtatcgtgggcgaacccacgtcgacagccgtattgggtgatgtcatcaagaat
ggccgacgggggtcgctatcaggcaaggttgtggtcaaaggcttgcagggccatgtggcc
tacccccatcttgcccgcaatccgattcatttgtgtgcgccggccttacatgaactggcg
agcaccgaatgggatcagggcaatgagtactttccgcccaccactttccagatttccaat
ttccatgcgggtacgggcgctaccaacgttgtccctggcagcgcgcaatttctgttcaat
atccggttttcgacagccagtaccgttgaatcgctcaagtcgcgtgtgcaggccattttg
gatgcacaccagctggacagcagcattgaatggacgcttggcggcgaaccatttctgacg
ccacgaggcgaactatcagaagccttgtcggccgcgatcaaggatgtgacgggtgtgcaa
acagcactgtcgactacgggtggaacgtcggacggtcggttcattgcgaaaatctgtccg
caagtgattgaatttgggccgatcaatgccactatccatcagattaacgagcacatcgag
gtcgacagcctggagccgctggccgccatttatcgtaaaacacttgaaaaccttctgcta
taa

DBGET integrated database retrieval system