KEGG   Advenella kashmirensis: TKWG_14435Help
Entry
TKWG_14435        CDS       T02117                                 

Definition
zinc-binding dehydrogenase family protein 6
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
aka  Advenella kashmirensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aka00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    TKWG_14435
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TKWG_14435
  Lipid metabolism
   00071 Fatty acid degradation
    TKWG_14435
  Amino acid metabolism
   00350 Tyrosine metabolism
    TKWG_14435
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TKWG_14435
   00626 Naphthalene degradation
    TKWG_14435
Enzymes [BR:aka01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     TKWG_14435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2496615..2497700)
Genome map
AA seq 361 aa AA seqDB search
MREHRNGKEMKCYCITGFKSPLQMIEKDDFTPQGTQVVLDVKAAGVCHSDLHLWEGGYDL
GQGKRLELKDRGVSLPLTPGHETVGTVRAMGPDAGQLDTQKNYLIYPWIGCGSCVVCQRG
EENLCAAPACLGIHRDGGYATQIVVPHPRYLVDIGDLDPVQAAPYACSGLTTYSALRKFD
LAVLQNEPVIIFGAGGLGLMCLQWLHAMGGKGAVVVDLDPAKREAALQAGALAAVDGNSP
TLIQDIQAAAGTRTIWSVIDYVGAPSTATQAFNLLAKGGKLVIIGLFGGQSEWSLALFPL
KAATVQGSYVGNLAELQELMALVRQGGIRPIPVSRHPLAQADQTLMALHAGKVIGRAVLT
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaacataggaatggtaaagagatgaaatgttactgcattactggtttcaagtcc
cccttgcagatgatcgagaaagacgactttacgccgcaagggacccaggtcgtactggac
gtcaaggcggccggggtctgtcatagcgacctgcacttgtgggagggcgggtacgatttg
ggccagggcaagcgcctggagctgaaggatcgcggcgtcagcctgccgctgacaccgggt
cacgagaccgtgggaacagtgcgagcaatggggccggatgcggggcagctggatactcaa
aaaaattacctgatctatccctggattggctgcggcagttgtgtggtctgccagcgtggc
gaagaaaatctgtgtgcggcgccggcctgcctgggcatccatcgtgatggcggctacgct
acccaaatcgtggtgccgcatccgaggtatctggtggatattggcgatctggatccggta
caggcagcgccttacgcctgttccggcctgaccacctattcggcgctgcgcaagtttgat
ctggcggtgctgcaaaatgagcccgtgatcatttttggcgccggcggcctgggcctgatg
tgcctgcaatggctgcacgccatgggcggcaagggggcggttgtcgtcgacctggatccg
gccaaacgcgaggccgcgttgcaggccggggcgttggcggctgttgatggtaacagccct
acgctgatccaggatattcaggcggcggcgggtacacgtaccatctggtccgtgatcgat
tatgtgggcgctccgtctacggcaacgcaggcgttcaatctgctggccaagggcggcaag
ctggtcattatcggtttattcggcggacagagcgagtggtcgctggcattatttcccttg
aaggccgctacggtgcagggatcctatgtgggcaatctggccgagttgcaggaattgatg
gcgctggtcagacagggtgggattcgtccaattcctgtcagccggcatcccctggcacag
gcagaccagactctgatggccttgcatgcaggcaaagtgatcggcagggcggttctgacg
ccgtaa

DBGET integrated database retrieval system