KEGG   Advenella kashmirensis: TKWG_14875Help
Entry
TKWG_14875        CDS       T02117                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
aka  Advenella kashmirensis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:aka01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:aka01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2572764..2573966)
Genome map
AA seq 400 aa AA seqDB search
MDTILDFISGGFLQLGWWQVILVTLVLTHITIAAVTIYLHRSQAHRGLDLHPVVSHFFRF
WLWLTTGMVTREWVAIHRKHHAKCEREGDPHSPMIYGIDRVLWKGAELYREEAANEETIK
RFSHGTPDDWMERNVYSRHTTLGIFTMLAIDLLLFGALGLTVWAVQMAWIPFWAAGVVNG
LGHYIGYRNFSSPDTSTNLFPIGIIIGGEELHNNHHAYGTSAKFSSKWYEFDIGWGYIRI
LQALRLAQVKKVAPKLKLVRDKSDSVTEQTLQGVITHRYEIMARYASMLRQSVQSEIKRL
TQSGASDQERELLQKVQSRLGQADLALNPQEKQELDSMLSQNTMLAKLVHMREELYRVWT
SSTASSEQLLGDLQQWCQHAQQSGIQGLEQFALRLRRYAA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggatacaattctcgattttatttccggtggctttttgcaacttggctggtggcaagtt
attcttgtcacgctggtgcttacgcacattaccattgcagcggtaacgatatatctgcac
cgcagtcaggctcaccgggggctggatctgcatccggtcgtttcgcatttctttcgcttc
tggctctggctgactaccgggatggtcacgcgcgagtgggtggctatccaccgcaagcac
catgcaaaatgcgaacgtgaaggcgatcctcactctcccatgatctacggtatcgaccgg
gtcttgtggaaaggggcagagctttatcgtgaagaggccgccaacgaagagaccatcaag
cgcttcagtcacggcacgcccgatgactggatggaacgcaacgtttattcccgccacacc
acactgggtattttcactatgctggccatcgacctgctgttgttcggcgcgcttggtctg
accgtgtgggctgtgcaaatggcatggatcccattctgggccgccggcgtggtcaacgga
ctgggtcactatatcggctaccgcaatttctccagtcccgacaccagcaccaatttgttc
cctatcggcatcatcatcggtggcgaagagttgcacaacaatcaccatgcctacggtacg
tccgccaagttttccagcaaatggtatgagttcgatatcggctggggctacatccggatc
ttgcaggcactacgcctggctcaggtcaagaaggttgcgcccaagctcaaactggtccgc
gacaagtccgactctgtgaccgagcaaaccctgcagggtgtgattacgcaccgctatgaa
atcatggcgcgttacgccagcatgctgcgccagtccgttcagtctgaaatcaagcgcctg
acccagtctggcgccagcgaccaggaacgtgagctgctgcagaaagtgcagtcgcgcctt
ggacaggccgacctggccttaaatcctcaggaaaaacaggagctcgacagcatgctgtcg
caaaacacgatgctggccaagctggttcatatgcgcgaagaattgtatcgcgtatggaca
agttccactgccagcagcgagcaattacttggtgatctgcaacagtggtgccagcatgcg
cagcaaagcggcattcagggccttgaacagtttgctctccgtctgcgccgctatgccgca
tga

DBGET integrated database retrieval system