KEGG   Advenella kashmirensis: TKWG_15385Help
Entry
TKWG_15385        CDS       T02117                                 

Definition
GTP cyclohydrolase I protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
aka  Advenella kashmirensis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aka00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2653956..2654696)
Genome map
AA seq 246 aa AA seqDB search
MSDSNIKKDNEQQSEQATHPDDRGYISTRIRQRIRQAGARFHANDNIARFIEPGELELLQ
QEVQEKMQAVLSSLVIDTESDHNTNETAKRVAKMYLREVFVGRYTEAPQVTEFPNIEKLN
ELMIVGPIQVRSACSHHLCPIMGKVWIGIMPNEHSNLIGLSKYARLVAWLMERPQIQEEA
VKHVADLLMKKVNPDGLAVVMDADHFCMQWRGVRDMESRMINSVMRGSFLNDSDLRREFL
SLIKAR
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgatagcaacataaaaaaggacaacgaacaacaatcggagcaggcgacgcatccg
gatgacaggggttatatttccacacggatccgccagcgtattcgccaggccggcgcccgc
tttcatgccaatgacaatatcgcccgctttatcgaacccggcgagcttgagctgctgcaa
caggaagtacaggaaaaaatgcaggcggtactctccagcctggtcatcgacaccgagagc
gatcacaacaccaatgaaaccgccaagcgggtggcaaagatgtatttgcgtgaagtcttc
gtcggccgttataccgaagcaccgcaagtgaccgagttccccaacatcgaaaaactcaat
gagctgatgattgtcgggccgattcaggtgcgcagcgcctgctctcatcatttgtgcccc
atcatgggcaaggtctggattggcatcatgcccaacgagcactccaatctcataggcctg
tcaaaatatgcaagactggttgcctggctgatggaacgcccgcaaatccaggaagaggcc
gtcaagcatgtggcagatttgctgatgaaaaaagtaaacccggacggcctggcggtagtc
atggatgccgaccacttttgcatgcaatggcgcggcgtcagggatatggaatcgcgcatg
atcaatagtgtcatgcgcgggtcctttctgaatgactcggatttgcgccgggaatttctg
tcgctgatcaaggcgcgttaa

DBGET integrated database retrieval system