KEGG   Advenella kashmirensis: TKWG_15620Help
Entry
TKWG_15620        CDS       T02117                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
aka  Advenella kashmirensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aka00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TKWG_15620
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TKWG_15620
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TKWG_15620
Enzymes [BR:aka01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TKWG_15620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2692743..2694176)
Genome map
AA seq 477 aa AA seqDB search
MKYISTRGGMSPVSFSEILLEGLARDGGLAVPESIPSVSAKQLELWRSLSYAELATEILS
LYIDDISRTDLERICKAAYNESVFSGSEIVPLKPLGKSMTLVGLSEGPTLAFKDLAMQFL
GQVFEFVLAREGRKLNILGATSGDTGSAAEYAMRGKLGVSVFMLSPHGRMSAFQRAQMYS
LMDENIHNISVKGVFDDCQDIVKALAGDVSFKTSYHLGAVNSINWARICAQIVYYFWAWL
RSTDAAAGTGTDVSGYKVSFTVPSGNFGNILSGHFARQMGLPIHRLVLATNENNVLEEFF
RTGVYRPRVSAETLATSSPSMDISKASNFERFVFDLLGRDAKRLAATWKKLEQEGAFDLS
AEKLRFTEEFGFVGGSSTHADRLETIRQVQEQAGILIDPHTADGVKVAQAFVEDGIPMLV
LETALPAKFGETILEATGQQAPVPDHLKSLADLPQKVVIMDNDVESIRDYIKARALL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatttcaacccgtggcggcatgagcccggtttcattttccgaaattcttctc
gaagggctggcacgcgacgggggccttgcggtgcccgagagcattccttcggtcagtgcc
aagcagctcgaactgtggcgctcgctctcttatgcggagctggccacggaaatattgagc
ctttacattgacgatatttcgcgtaccgacctggaacgcatctgcaaggcggcctataac
gaatcggttttctcgggcagcgagattgtgccgcttaaaccgctgggcaaatcaatgacg
ctggtgggcctgtccgaaggtcccacgctggcgttcaaggatctggccatgcagtttctg
gggcaggtttttgagtttgtgctggcgcgcgaaggtcgcaagttgaatattctgggcgcc
acctcgggcgataccggctctgcggcggagtacgccatgcgcggcaagctgggcgtgtct
gttttcatgctgtcgccacatggacgcatgagcgcctttcagcgtgcccagatgtattcg
ctgatggacgaaaatattcataatatttcggtcaaaggcgtattcgatgattgccaggat
atcgtcaaggcgttggccggcgatgtctcgttcaagaccagttaccatcttggtgcggtc
aattccatcaactgggctcgtatctgcgcgcagattgtatattacttctgggcgtggctg
cgcagcaccgatgctgcggccggcaccggtaccgacgtgtccggttacaaggtatcgttc
acggtgccatcgggcaatttcggcaatattttgtccggccatttcgcgcgccagatgggg
cttcccattcatcgcctggtattggcaaccaacgagaacaatgtgctggaagagtttttc
cgtacaggtgtttatcgtccccgcgtcagcgccgaaacccttgctacttccagcccgtcc
atggatatttccaaggcgtccaatttcgagcgttttgtattcgacctgttggggcgcgac
gccaaacggctggctgcaacctggaaaaaactggagcaggaaggggcatttgacctgtct
gcagaaaaattgcgttttaccgaagagttcggtttcgtcggtggcagcagcacgcatgcg
gatcgcctggaaacgatccgccaggtgcaagagcaagccggcattctgatcgacccgcat
acggccgatggtgtgaaggtcgcccaggcattcgtcgaagacggcattccaatgctggtt
ctggaaaccgcgttgccagccaagtttggcgagactattctggaagccaccggccagcag
gcccccgttcctgaccatctgaagtcgctggcagatttgccgcagaaagtggtcattatg
gacaatgatgtggagtccatacgcgattacatcaaggcgcgggcattgctctga

DBGET integrated database retrieval system