KEGG   Advenella kashmirensis: TKWG_15620Help
Entry
TKWG_15620        CDS       T02117                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
aka  Advenella kashmirensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aka00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TKWG_15620
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TKWG_15620
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TKWG_15620
Enzymes [BR:aka01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TKWG_15620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2692743..2694176)
Genome map
AA seq 477 aa AA seqDB search
MKYISTRGGMSPVSFSEILLEGLARDGGLAVPESIPSVSAKQLELWRSLSYAELATEILS
LYIDDISRTDLERICKAAYNESVFSGSEIVPLKPLGKSMTLVGLSEGPTLAFKDLAMQFL
GQVFEFVLAREGRKLNILGATSGDTGSAAEYAMRGKLGVSVFMLSPHGRMSAFQRAQMYS
LMDENIHNISVKGVFDDCQDIVKALAGDVSFKTSYHLGAVNSINWARICAQIVYYFWAWL
RSTDAAAGTGTDVSGYKVSFTVPSGNFGNILSGHFARQMGLPIHRLVLATNENNVLEEFF
RTGVYRPRVSAETLATSSPSMDISKASNFERFVFDLLGRDAKRLAATWKKLEQEGAFDLS
AEKLRFTEEFGFVGGSSTHADRLETIRQVQEQAGILIDPHTADGVKVAQAFVEDGIPMLV
LETALPAKFGETILEATGQQAPVPDHLKSLADLPQKVVIMDNDVESIRDYIKARALL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatttcaacccgtggcggcatgagcccggtttcattttccgaaattcttctc
gaagggctggcacgcgacgggggccttgcggtgcccgagagcattccttcggtcagtgcc
aagcagctcgaactgtggcgctcgctctcttatgcggagctggccacggaaatattgagc
ctttacattgacgatatttcgcgtaccgacctggaacgcatctgcaaggcggcctataac
gaatcggttttctcgggcagcgagattgtgccgcttaaaccgctgggcaaatcaatgacg
ctggtgggcctgtccgaaggtcccacgctggcgttcaaggatctggccatgcagtttctg
gggcaggtttttgagtttgtgctggcgcgcgaaggtcgcaagttgaatattctgggcgcc
acctcgggcgataccggctctgcggcggagtacgccatgcgcggcaagctgggcgtgtct
gttttcatgctgtcgccacatggacgcatgagcgcctttcagcgtgcccagatgtattcg
ctgatggacgaaaatattcataatatttcggtcaaaggcgtattcgatgattgccaggat
atcgtcaaggcgttggccggcgatgtctcgttcaagaccagttaccatcttggtgcggtc
aattccatcaactgggctcgtatctgcgcgcagattgtatattacttctgggcgtggctg
cgcagcaccgatgctgcggccggcaccggtaccgacgtgtccggttacaaggtatcgttc
acggtgccatcgggcaatttcggcaatattttgtccggccatttcgcgcgccagatgggg
cttcccattcatcgcctggtattggcaaccaacgagaacaatgtgctggaagagtttttc
cgtacaggtgtttatcgtccccgcgtcagcgccgaaacccttgctacttccagcccgtcc
atggatatttccaaggcgtccaatttcgagcgttttgtattcgacctgttggggcgcgac
gccaaacggctggctgcaacctggaaaaaactggagcaggaaggggcatttgacctgtct
gcagaaaaattgcgttttaccgaagagttcggtttcgtcggtggcagcagcacgcatgcg
gatcgcctggaaacgatccgccaggtgcaagagcaagccggcattctgatcgacccgcat
acggccgatggtgtgaaggtcgcccaggcattcgtcgaagacggcattccaatgctggtt
ctggaaaccgcgttgccagccaagtttggcgagactattctggaagccaccggccagcag
gcccccgttcctgaccatctgaagtcgctggcagatttgccgcagaaagtggtcattatg
gacaatgatgtggagtccatacgcgattacatcaaggcgcgggcattgctctga

DBGET integrated database retrieval system