KEGG   Advenella kashmirensis: TKWG_16585Help
Entry
TKWG_16585        CDS       T02117                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
aka  Advenella kashmirensis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:aka00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TKWG_16585
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TKWG_16585
   00650 Butanoate metabolism
    TKWG_16585
  Energy metabolism
   00190 Oxidative phosphorylation
    TKWG_16585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2861302..2861679)
Genome map
AA seq 125 aa AA seqDB search
MAKELVGTKRLVVGAGYGIKDFIVQRITAVILAVYSVIFLIAALFTPINYESWKGFFTFS
CWGLPVGQIAATLAFFSLAWHAWIGVRDIWMDYVKPVGVRLTLQVLTILWLIAAILYFAK
IVWSL
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggaactggtaggtactaagcggctggttgtgggtgccggctacggtatcaag
gatttcatcgtacagcgtattacagccgtgattctggctgtgtattcagtcattttcctg
attgctgcgctgttcacccccattaactacgaatcctggaagggtttctttacgttctcc
tgttggggcctgcccgtcgggcagattgccgcaacgctggcgtttttctcgcttgcctgg
catgcgtggatcggcgtgcgcgatatctggatggattacgtcaagcccgtaggtgtccga
ctgacgttgcaggtgctcactatcctgtggctgattgccgccatcctgtatttcgcaaaa
attgtctggagtttataa

  All links  
No link information was found.   
DBGET integrated database retrieval system