KEGG   Advenella kashmirensis: TKWG_18340Help
Entry
TKWG_18340        CDS       T02117                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
aka  Advenella kashmirensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:aka00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TKWG_18340 (ruvA)
Enzymes [BR:aka01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     TKWG_18340 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3154797..3155294
Genome map
AA seq 165 aa AA seqDB search
MGYDIDVPMSTFYDLPEAGARVTLYTHLAIRDDAHVLYGFLRQDERATFRALIKVTGIGA
RTALAVLSGMSSADLSAAIAQQDTALLTRVPGIGKKTAERLLLELRGKLDAIAPATPAAT
GQNDVLNALLALGYSDREARATVKSLPADLGVSEGIRAALKILSS
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
gtgggctacgatatcgacgtgcccatgagcacgttctatgacttgcccgaagcgggcgcc
agggtcacgctatacacccacctggccatccgcgacgatgcgcatgtcctttacggcttt
ctgcgacaggatgaacgtgccaccttccgggccctgatcaaggtcaccggcatcggtgct
cgcacggccctggcggtactctcgggcatgagcagcgcggatctgtcggccgcgatcgcc
cagcaggacaccgccctgctcacccgggtgccgggcatcggcaagaagacggcggaacgc
ctgttactggagttgcgcggcaagctcgatgccattgcaccggccacgcctgcggccaca
ggccagaatgatgtgctcaatgcgttgctggcgcttgggtattccgatcgcgaagcgcgg
gcgacggtcaaatcgttgccagccgatctgggcgtttccgaaggcatccgcgccgcgctc
aagatactgtccagctaa

DBGET integrated database retrieval system