KEGG   Advenella kashmirensis: TKWG_18910Help
Entry
TKWG_18910        CDS       T02117                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
aka  Advenella kashmirensis
Brite
Enzymes [BR:aka01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     TKWG_18910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3260966..3262033)
Genome map
AA seq 355 aa AA seqDB search
MIKGEKQSGRTWSGLMLLAALLAGVQGSELRSAHSAPQADAELMRSLKQKYQRPQSVPYP
ADNPHSQAKEELGRKLFFDSRLSRASRSCATCHDPGKRWSDGLVQPVGSGQQEFARRTPT
LLNSAWLSALMWDGRANTLEQQAVMPITAEHEMNMPVALLLERINALDDYAQPVQRAYGR
VQQITVEHIQQALATFERSLVSPRTDLDRWIAGDTQALTTQEQRGFAIYNGKARCSACHS
TWRLTDDGFHDIGLASADRGRGKFTPPQVVGMQHAFKTPTLRELNDKGPYMHDGSIDSLE
AVIKHYEEGGIDRPSRSPEMQPFTLTEQERADLLAFLRALGRNPVTQAATGQLEN
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaaaggcgagaaacaaagcgggcgtacgtggtcaggcctgatgctgctggcagca
ttgcttgccggtgtgcaggggtctgaactgcgtagcgctcacagtgccccgcaagcggat
gccgaattgatgcggtcgctcaaacagaagtatcagcgaccgcaatcggtgccctatccg
gcagacaatccccattcgcaggcaaaagaggaactggggcgcaagctgttttttgactcg
cgactctcgcgcgcaagccgctcttgtgccacctgtcacgatcccggcaaacgctggagc
gatggtctggttcaaccggtgggttccgggcaacaggaatttgcccgtagaacaccgacg
ctgctcaacagcgcctggctgtccgctctcatgtgggacggacgcgccaatacgttggaa
cagcaagcggtcatgcctattacggccgagcatgaaatgaatatgccggtggcgctgttg
ctggagcgtatcaatgcgctggacgattacgcacaaccggtgcagcgcgcctacgggcgt
gtacagcaaattactgtcgagcatatccagcaggcgctggctactttcgagcgctcgctg
gtatcgccgcgcaccgatctggatcgctggatcgccggtgatacgcaggcgctgaccaca
caggagcagcgcggttttgctatctacaatggcaaggcccgctgcagcgcatgccacagt
acctggcgtttgactgatgatggttttcatgacatcgggctggccagcgctgatcgtggc
cggggaaagtttacgccaccccaggtggttggcatgcagcatgccttcaagacgccgacg
ttgcgtgaactgaacgataaggggccctatatgcacgacggctcaatcgactcgctggaa
gcagtaatcaagcattatgaggagggcggcattgacaggcccagtcgttctccggaaatg
caaccctttacgttgacggaacaggaacgcgcagaccttttggcattcctgcgggcactt
ggcagaaatcccgtgacccaggccgcaaccggccaattggagaactga

DBGET integrated database retrieval system