KEGG   Advenella kashmirensis: TKWG_20385Help
Entry
TKWG_20385        CDS       T02117                                 

Definition
phosphoglucomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
aka  Advenella kashmirensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aka00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TKWG_20385
   00030 Pentose phosphate pathway
    TKWG_20385
   00051 Fructose and mannose metabolism
    TKWG_20385
   00052 Galactose metabolism
    TKWG_20385
   00500 Starch and sucrose metabolism
    TKWG_20385
   00520 Amino sugar and nucleotide sugar metabolism
    TKWG_20385
  Nucleotide metabolism
   00230 Purine metabolism
    TKWG_20385
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TKWG_20385
Enzymes [BR:aka01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     TKWG_20385
    5.4.2.8  phosphomannomutase
     TKWG_20385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3503672..3505060
Genome map
AA seq 462 aa AA seqDB search
MTPALPQSVFKAYDIRGIVPEQLNASFAYLLGRALARRARACGTDRIVVGYDGRLSSPEL
SAALQKGILDEGIDTVDIGMVPTPLVYFESYSENIGAAVAITGSHNPPKYNGFKMMIGGK
ALYGDDVLALREQMQALQSEPVAAVKGVAHRKDIVQTYIERIVSDVKLTRPMKIAIDCGN
GVGGVVATKLFRALGCEVIELYCDVDGTFPNHHPDPADPHNLEDLQRTLRETDCEIGLAF
DGDGDRLGVVTRSGSIIWPDRQLILFARDILARQPGATIIYDVKCSRHVTASVLAAGGVP
LMWRTGHSLIKAKLAETGAPIAGEMSGHVFFKERWFGFDDGLYTGARLLEILSREPNPTA
VLDALPEGISTPELKLDMEEGQQYSLIKTLQEKAHFPGATSVNTIDGVRAEYEDGFGLAR
ASNTTPVIVLRFEGESQQAIDRIRAEFKAVFAQFAPGAALPF
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaccccagcgcttccccaatccgtattcaaggcttatgacattcgtggtattgtgcct
gaacagctcaatgcctcgtttgcctacctgctggggcgcgcgctggcccggcgtgcccgc
gcctgcggcacggaccggatcgtggtgggctacgatggacgcctgtccagcccggagctg
tccgccgccctgcaaaagggcattctggatgaaggcattgatacggtagacatcggcatg
gtgcccacgccactggtgtatttcgaatcctactccgaaaatatcggcgccgccgttgcc
attaccggcagccataacccgccaaaatacaatggcttcaaaatgatgatcggcggcaag
gccctgtacggcgacgacgtactggccctgcgcgagcagatgcaggcgctgcaatctgag
ccggtagctgcagtaaaaggcgttgcacatcgcaaggacattgtccagacgtatatagag
cggattgtgtcggacgtgaagctgacccgcccgatgaaaattgccatcgattgcggcaat
ggcgtgggcggcgtggtcgcaaccaaactgtttcgcgcgcttggctgcgaggtgatcgag
ctgtattgcgatgtggatggcacctttcccaatcaccaccccgatcctgccgacccccac
aacctggaagacctgcagcgcaccctgcgggagaccgactgcgaaatcggtctggccttc
gacggtgacggtgaccgcctgggcgttgtcacccgcagcggcagcatcatctggccggac
cgccagttgattctttttgcccgcgatattcttgcgcgccagcctggcgcgaccattatc
tatgacgtcaaatgcagccgtcacgtgaccgcctctgttctggcagccggcggcgtgccg
ctcatgtggcgcaccggtcattcgctgatcaaggccaagctggcggaaaccggcgcccct
attgcaggtgaaatgagcggccatgttttcttcaaggaacgctggttcggctttgatgac
ggcctgtataccggcgcgcgcctgctggaaatcctctcgcgcgagcccaaccccaccgcc
gtgcttgatgccctgccagagggcatttccacgccggaacttaagctggacatggaagaa
ggccagcaatattcgctgatcaagactttgcaggaaaaagcgcattttccgggcgccacc
agcgtcaataccattgacggcgtacgcgccgaatatgaagacggctttggcctggcgcgt
gcgtccaataccacacctgtgattgtgttgcgttttgaaggcgagtcgcagcaggcgatt
gatcgcatccgtgcagaattcaaagcggtgttcgcccagtttgcgccgggcgcggcgctg
ccgttctga

DBGET integrated database retrieval system