KEGG   Advenella kashmirensis: TKWG_21375Help
Entry
TKWG_21375        CDS       T02117                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
aka  Advenella kashmirensis
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:aka00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3674902..3675681)
Genome map
AA seq 259 aa AA seqDB search
MNAPLREKSYFDKRVTQEMSKHLQVVERDTKETMAYACRILAMTEQEAGLAGQISVRSER
PGAYWTLRFGLGFDEAKPEDFIEVDRDLNTLTGAGMANPATRFHLWVYDARPDVNCIIHT
HSPWASALAAARQPLVISQMDMTPLHNDCAFLGEWPGVPIADDEGVIISEALGEKKAIIL
AHHGYLTAGTSCEEATYLSVYLERAARMQIRAQAFGKLTPVDDTLAAEAHDYLLKTSIVK
ATFNYWCRQTHGIAALDLK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgccattaagagaaaaatcctacttcgataagcgggtaacccaggagatgtcg
aagcatctgcaagttgtagagcgggatacaaaagagacaatggcctacgcctgtcgaatc
ctggccatgactgagcaggaagcgggcctggcaggacagatcagcgtccggtccgagcgc
ccgggcgcttattggaccttgcgttttggcctggggtttgatgaggcgaaacctgaagac
ttcatcgaagtggatcgcgatctgaatacattgaccggggcaggaatggccaaccccgcg
acacgttttcatctgtgggtctatgacgcgcggccagatgtcaattgtattattcatacc
cattcgccctgggcgtcggcactggctgccgcgcggcaaccattggtgatctcccaaatg
gatatgacccccttgcataacgattgcgcatttctgggggaatggccgggtgtaccgatt
gctgatgacgaaggcgtgattatttcagaggcgctgggcgagaaaaaggcgattatcctg
gcccatcatgggtatttgaccgcgggcacgtcctgtgaagaggcgacctacctgtcggtt
tatcttgaacgcgcggcccgtatgcagattcgtgcgcaggcatttggcaagctgaccccc
gtggacgacacgcttgctgccgaagcccacgactatctgctgaagacttcaatcgtcaag
gcaaccttcaattactggtgcagacagacgcatggcattgctgcgctggatctgaagtag

DBGET integrated database retrieval system