KEGG   Advenella kashmirensis: TKWG_21375Help
Entry
TKWG_21375        CDS       T02117                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
aka  Advenella kashmirensis
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aka00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    TKWG_21375
Enzymes [BR:aka01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     TKWG_21375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3674902..3675681)
Genome map
AA seq 259 aa AA seqDB search
MNAPLREKSYFDKRVTQEMSKHLQVVERDTKETMAYACRILAMTEQEAGLAGQISVRSER
PGAYWTLRFGLGFDEAKPEDFIEVDRDLNTLTGAGMANPATRFHLWVYDARPDVNCIIHT
HSPWASALAAARQPLVISQMDMTPLHNDCAFLGEWPGVPIADDEGVIISEALGEKKAIIL
AHHGYLTAGTSCEEATYLSVYLERAARMQIRAQAFGKLTPVDDTLAAEAHDYLLKTSIVK
ATFNYWCRQTHGIAALDLK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgccattaagagaaaaatcctacttcgataagcgggtaacccaggagatgtcg
aagcatctgcaagttgtagagcgggatacaaaagagacaatggcctacgcctgtcgaatc
ctggccatgactgagcaggaagcgggcctggcaggacagatcagcgtccggtccgagcgc
ccgggcgcttattggaccttgcgttttggcctggggtttgatgaggcgaaacctgaagac
ttcatcgaagtggatcgcgatctgaatacattgaccggggcaggaatggccaaccccgcg
acacgttttcatctgtgggtctatgacgcgcggccagatgtcaattgtattattcatacc
cattcgccctgggcgtcggcactggctgccgcgcggcaaccattggtgatctcccaaatg
gatatgacccccttgcataacgattgcgcatttctgggggaatggccgggtgtaccgatt
gctgatgacgaaggcgtgattatttcagaggcgctgggcgagaaaaaggcgattatcctg
gcccatcatgggtatttgaccgcgggcacgtcctgtgaagaggcgacctacctgtcggtt
tatcttgaacgcgcggcccgtatgcagattcgtgcgcaggcatttggcaagctgaccccc
gtggacgacacgcttgctgccgaagcccacgactatctgctgaagacttcaatcgtcaag
gcaaccttcaattactggtgcagacagacgcatggcattgctgcgctggatctgaagtag

DBGET integrated database retrieval system