KEGG   Advenella kashmirensis: TKWG_22265Help
Entry
TKWG_22265        CDS       T02117                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
aka  Advenella kashmirensis
Pathway
aka00260  Glycine, serine and threonine metabolism
aka00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aka01100  Metabolic pathways
aka01110  Biosynthesis of secondary metabolites
aka01130  Biosynthesis of antibiotics
aka01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aka00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TKWG_22265 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TKWG_22265 (trpA)
Enzymes [BR:aka01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TKWG_22265 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB ThiG PEP_mutase BtpA
Motif
Other DBs
NCBI-ProteinID: AFK64101
UniProt: I3UGG3
Position
complement(3819403..3820212)
Genome map
AA seq 269 aa AA seqDB search
MSRLQQRFAQLKNENRAALVTFLTAGDPDYDTAAAILNGLPQAGADIIELGMPFTDPMAD
GPAIQLSSLRALAQGQNVAATLKMIGEFRQHDNETPIVLMGYFNPIHRYGVDRFIADAGK
AGVDGLIVVDLPAEHDRDLCLPAQAAGIDFVRLTTPTSDDARLQQILGNAGGFVYYVSVA
GTTGAGSATIEHVQQAVTRIRRHTDLPVSVGFGIRTPEQAANIARVADGVVVGSALVQKI
AQAKNGEQARTDVLGLCSELAQAVRKARN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcctgcaacagcgttttgcacaactgaagaacgagaatcgcgcagccctggtc
acatttttaactgccggtgatccggactatgacaccgccgccgccattcttaacggattg
ccacaagcgggcgccgatattatcgaacttggcatgccgtttaccgatccgatggccgac
ggccctgccattcagctttccagccttcgcgcactggcgcagggtcagaatgttgccgcc
accctgaaaatgatcggtgagtttcggcagcacgataacgaaacgccgattgtgctgatg
gggtatttcaatcctattcaccgctatggcgtggatcggtttattgccgacgcaggcaag
gcgggggtggatgggctgatcgtggtggatctgccggctgaacacgatcgtgatctttgc
cttccggcgcaggctgctggcatcgactttgtacgtttgaccacacccacaagcgatgac
gcgcgtttgcagcagatcctgggtaatgccggcggctttgtctattacgtttctgttgcg
ggcaccaccggtgccggttcagcgaccatagagcatgttcagcaagcggtcacaaggatt
cgcaggcatacggatctgccggtcagtgtcgggttcgggattcggacaccggaacaggca
gccaatattgcccgggtagccgatggcgttgtggtcggctcggcgctggtgcagaagatt
gcgcaggcaaaaaatggtgagcaggcccgcacagatgtgctggggctttgcagtgaactg
gcgcaagcggtacgcaaggcgcgtaattga

DBGET integrated database retrieval system