KEGG   Advenella kashmirensis: TKWG_22270Help
Entry
TKWG_22270        CDS       T02117                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aka  Advenella kashmirensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aka00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TKWG_22270
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TKWG_22270
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TKWG_22270
Enzymes [BR:aka01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TKWG_22270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3820209..3821420)
Genome map
AA seq 403 aa AA seqDB search
MVSLNTNTGAAGMFGEFGGQYVAETLMPLIHELAAEYEKASTDESFQKELAYFQRDYVGR
PSPLYYAERLTEHLGGAKIYLKREELNHTGAHKINNCIGQILLARRMGKKRIIAETGAGM
HGVATATVAARFGLQCVIYMGSTDIDRQQANVFRMKLLGAQVLPVTAGTGTLKDAMNEAL
RDWVTNVDTTYYLIGTVAGPHPYPTMVRDFQAVIGRETREQMLAQEGRLPDSLVACVGGG
SNAIGLFHEFLDDKDVKIIGVEAAGHGIESGKHAASLNGGVPGVLHGNRTFLLQDDDGQI
IDAHSISAGLDYPGIGPEHAWLHSIGRVQYTAITDDEALDALHQCCRLEGIIPALESAHA
LAEAFKQAPSLPGDHLMVVNLSGRGDKDMQTVMQHSKEKEQQA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggtttcattgaatacaaatacaggcgcggcagggatgttcggcgagttcggcggacaa
tacgttgccgaaacgctcatgccgctcattcacgaactggctgccgaatacgaaaaagcc
agcaccgatgaaagctttcaaaaggaattggcctattttcagcgggactatgtaggacgg
cccagcccactctattatgcagagcggctgaccgaacatctgggcggggcgaaaatttac
ctcaagcgtgaagagcttaatcataccggcgcccacaaaatcaataactgtatcggccag
attctgctggcgcgacgcatgggcaagaaaagaattattgccgagaccggcgccgggatg
cacggggtcgcaacagccactgtggctgcccgctttggtttgcaatgcgtcatttacatg
ggtagcaccgatattgatcgccagcaggccaacgtatttcgtatgaaattgttgggcgcg
caagtgttgcctgtcacagcaggcactggcacgctaaaggacgccatgaacgaggccctg
cgtgattgggtcaccaatgtcgacaccacctattatctgattggtacggtggctggtcct
catccctatccaacgatggtccgggatttccaggcagtgatcggtcgcgaaacccgcgag
cagatgctggcccaggaaggccgcctgcccgactcgcttgtcgcctgcgtagggggcggg
tccaacgccattggcctattccatgaatttctggatgacaaggatgtgaagattatcggc
gtggaagcagccggccatggtattgaaagcggcaagcatgcagcgagcctgaacggtggt
gtgcccggcgtattgcacggcaatcgtacgttcttactgcaggatgacgatggacagatt
attgatgcgcattcgatctctgccggtctggattatccgggcattggtcccgagcacgcc
tggctgcacagtattggccgggtgcagtatacggcgattacggatgacgaagcgcttgac
gccctgcatcaatgctgccgcctggaagggattattcctgcgctggaaagcgctcatgca
ctggccgaagcgttcaaacaggcgccttctctgcccggcgatcacctgatggtcgtgaac
ctgtccgggcgcggagacaaggatatgcaaactgtgatgcaacatagcaaagagaaggag
caacaagcatga

DBGET integrated database retrieval system