KEGG   Advenella kashmirensis: TKWG_24000Help
Entry
TKWG_24000        CDS       T02117                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aka  Advenella kashmirensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aka00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TKWG_24000
   00052 Galactose metabolism
    TKWG_24000
   00500 Starch and sucrose metabolism
    TKWG_24000
   00520 Amino sugar and nucleotide sugar metabolism
    TKWG_24000
Enzymes [BR:aka01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     TKWG_24000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4139203..4140039)
Genome map
AA seq 278 aa AA seqDB search
MNPIRKAVFPVAGLGTRFLPATKAMPKEMLPVVDKPLIQYAVEEAVKAGITDLIFITGRH
KRAIEDHFDSMPELESELEEKGKQEMLEQVRQVIPSNVNCIYIRQPAPLGLGHAVLCAEP
VVGNEPFAVLLADDLIDSNVPVTQQLIQAAHANNGSVLGIQTIAREDSNKYGIIAGKSVS
SNTIQVNQIVEKPAPADAPSDKAVVGRYILEPEIFEYLRHIGKGAGGEIQLTDGIAALLK
SRNVFGFAYEGTRYDCGSKAGFFAATVALGQKYHGFKL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgatccgtaaagctgtatttcccgtcgcaggcctgggcacccgctttttgccg
gcgaccaaggccatgcctaaagagatgctgcccgttgtggataagccccttatccaatac
gcagtggaagaggcagtcaaggctggcattaccgatctgattttcattacggggcggcac
aagcgcgcgatcgaggatcattttgactccatgcccgagctggaatccgaactggaagaa
aagggcaagcaggagatgctggagcaggtgcggcaggtcattccatccaacgtcaattgc
atttacatccgccagccggcaccgctgggcctgggccacgccgtgctgtgtgctgaacct
gtagtgggcaatgagccgttcgctgtgttactggccgatgatctgattgattcgaacgtg
ccggtgacccagcaactgattcaggctgcccatgccaataacggaagtgtgcttggtatc
cagaccattgctcgcgaagactccaataaatacgggattatcgcgggtaaatcggtgtcg
tccaacacgatccaggtgaaccagatcgttgaaaaaccggcgccggccgatgccccttca
gacaaggccgtggtgggtcgctatattctcgaaccggagatttttgaatacctgcgccac
atcggcaagggtgccggtggcgagatccagcttaccgacggcattgctgccttgctcaaa
agccgtaatgtatttgggtttgcctacgaaggtacgcgctacgattgcggtagcaaggca
ggcttttttgccgccacggtagcgctaggccagaaataccacggcttcaagctgtaa

DBGET integrated database retrieval system