KEGG   Azospirillum lipoferum: AZOLI_0164Help
Entry
AZOLI_0164        CDS       T01658                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ali  Azospirillum lipoferum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AZOLI_0164 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZOLI_0164 (glk)
   00052 Galactose metabolism
    AZOLI_0164 (glk)
   00500 Starch and sucrose metabolism
    AZOLI_0164 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    AZOLI_0164 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AZOLI_0164 (glk)
   00524 Butirosin and neomycin biosynthesis
    AZOLI_0164 (glk)
Enzymes [BR:ali01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     AZOLI_0164 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(157757..158728)
Genome map
AA seq 323 aa AA seqDB search
MAVSPILVADIGGTNARFGLIDGRTVRDTRVLRCADYASIEDAATAYLSAIGLAAPGTPG
RPRRGAFAVAGPVTGDRIAMTNLVWQFSVGRVRDALGLEGLAVINDFTAVALSVPRLAEE
DRRQVGEGSPQPGAVVAVLGPGSGLGVSGLVPGANGRWTALSGEGGHVTMAPMSDRESAV
LGQLRKGFDHVSAERVLSGPGLVNLYTALSILDGREPAALTPAQITDNALAGTEPHCVEA
VEMFCAMLGTVAGNLALTLGARGGVYIAGGIVPRLGTLFAHSRFRKRFAEKGRMRDFLAP
IPTYVVIHELPAFLGLAEAAGTE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggccgtctctcccatcctcgttgccgacatcggcggcaccaacgcgcgcttcggcctg
atcgacggccggacggtgcgcgacacgcgggtgctgcgctgcgccgactatgcctcgatc
gaggatgcggccaccgcctacctctccgcgatcgggctggcggcgccgggcacgccgggc
cggccgcggcgcggcgccttcgcggtggcggggccggtcaccggcgaccgcatcgccatg
accaatctggtctggcaattctccgtcggccgggtgcgcgacgctttggggctggagggg
ctggccgtcatcaacgacttcaccgccgtcgccctgtcggtgccgcgtctggccgaggag
gaccgccggcaggtcggcgaaggctctccgcagccgggtgccgtcgtcgccgtgctgggg
ccgggcagcgggctgggcgtgtcggggctggtgccgggggcgaacggccgctggaccgcg
ctgtcgggcgagggcggccatgtcaccatggcgccgatgagcgaccgcgagagcgccgtg
ctgggccagctgcgcaagggcttcgaccatgtctcggccgagcgggtgctgtcggggccg
gggctcgtcaacctctacaccgccctgtcgatcctggacgggcgcgaaccggccgccctt
acccccgcccagatcaccgacaacgcgctggccggaaccgagccccattgcgtggaggcg
gtggagatgttctgcgccatgctgggcaccgtcgccggcaacctagccttgacgctgggc
gcgcggggcggcgtctacatcgccggcggcatcgtgccgaggctggggacgctgttcgcc
cattcccgcttccgcaagcgcttcgccgagaagggccgcatgcgcgacttcctggccccg
atccccacctatgtcgtcatccacgagctgcccgccttcctgggcctcgccgaggctgcc
gggacggagtga

DBGET integrated database retrieval system