KEGG   Azospirillum lipoferum: AZOLI_0237Help
Entry
AZOLI_0237        CDS       T01658                                 

Gene name
aceB
Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ali  Azospirillum lipoferum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AZOLI_0237 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZOLI_0237 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    AZOLI_0237 (aceB)
Enzymes [BR:ali01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AZOLI_0237 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(229651..231255)
Genome map
AA seq 534 aa AA seqDB search
MATSMPSLEIRGPMKPGFEEILTPEAMAFLAELEGRFGPERLRLLDVRTKRQALLDQGHK
PDFLPETRAIREADWTISPLPVDLLDRRVEITGPVDRKMVINALNSGAKVFMADYEDATC
PTWTNLVEGQINIRDAVRRTISHEDPASGKKYRLSDKTAVLKIRPRGWHLDESHVLMEGE
PMSGALFDFGLHVFHNAKELLARGSGPYFYLPKLESHFEARLWREVFLVAEEYLHLPHGS
IKATVLIETILAAFEMDEILYELREHSAGLNCGRWDYIFSFIKKFRKDPAAVMPDRAEVT
MAAPFLSAYSQLAIKTCHRRGAPAIGGMAAFIPVKDNLEANEVAFSRVRADKEREASNGH
DGTWVAHPGLVPVAREVFDAYMTTPNQIARKRTDVTVTAADLLAVPAGPKTEGALRNNVA
VGIGYIEAWLRGQGCVPLFNLMEDAATAEISRTQVWQWVHTGTMLDDGQLVTLDLVDRIV
AEELSAWKDRVGAEAYAGGRYADAAALFRDLVAREDFTEFLTLPAYQRVVAEGA
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggccaccagcatgcccagccttgagatccgcggtccgatgaagcccggtttcgaggag
atcctgacgccggaggcgatggccttcctggcggagctggagggtcgcttcgggcctgag
cggctgcggctgctggacgtgcggaccaagcggcaggcgctgctcgaccagggccacaag
ccggacttcctgccggaaacccgcgccatccgcgaagccgactggaccatcagcccgctg
cccgtcgacctgctcgaccgccgggtggagatcaccgggccggtcgaccgcaagatggtc
atcaacgcgctgaacagcggcgccaaggtcttcatggccgattacgaggatgccacctgc
ccgacctggaccaatctggtcgaggggcagatcaacatccgcgacgccgtgcgccggacc
atttcccacgaggatccggccagcggcaagaaataccgcctcagcgacaagaccgccgtc
ctgaaaatccgcccgcgcggctggcatctggacgagagccatgtgctgatggaaggcgag
ccgatgtcgggcgcgctgttcgacttcggcctgcatgtcttccacaacgccaaggagctt
ctggcccgcggcagcggcccctatttctacctgcccaagctggaaagccatttcgaggct
cggctgtggcgcgaggtcttcctggtggcggaggagtatctccacctgccccacggctcg
atcaaggcgacggtgctgatcgagaccatcctcgccgccttcgagatggacgagatcctg
tatgagctgcgcgagcattccgccggcctgaattgcgggcgctgggattacatcttcagc
ttcatcaagaagttccggaaggatcccgccgccgtcatgcccgaccgggccgaggtgacg
atggccgcccccttcctgtcggcctacagccagctggcgatcaagacctgccaccgccgc
ggcgcgccggccattggcggcatggccgccttcattccggtcaaggacaatctggaagcg
aacgaggtcgccttctcccgcgtgcgcgccgacaaggagcgcgaggcgtccaacggccat
gacggcacctgggtcgcccatcccggtctggtgccggtggcgcgcgaggtgttcgacgcc
tacatgaccacgcccaaccagatcgcccgcaagcgcaccgacgtgaccgtcaccgccgcc
gacctgctggcggtccccgccgggccgaagaccgaaggggccttgcgcaacaacgtggcg
gtcggcatcggctatatcgaggcatggctgcgcggccagggctgcgtcccgctgttcaac
ctgatggaggacgccgccaccgcggagatcagccgcacccaggtctggcagtgggtccac
accggcacaatgctggacgacggtcagctcgtcaccctcgacctcgtcgaccgcatcgtc
gcggaagagctgtccgcctggaaggaccgtgtcggcgccgaggcctacgccgggggccgt
tatgccgatgccgccgccctgttccgcgatctggtcgcgcgcgaggacttcacggagttc
ctgaccctgccggcctaccaacgcgtggtggcggaaggggcgtaa

DBGET integrated database retrieval system