KEGG   Azospirillum lipoferum: AZOLI_0296Help
Entry
AZOLI_0296        CDS       T01658                                 

Gene name
cycM
Definition
(GenBank) Cytochrome c
  KO
K08738  cytochrome c
Organism
ali  Azospirillum lipoferum
Pathway
ali02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ali00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AZOLI_0296 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 CbtB
Motif
Other DBs
NCBI-ProteinID: CBS85699
UniProt: G7Z8D8
Position
283718..284257
Genome map
AA seq 179 aa AA seqDB search
MSMEWNKVFGAVLLAGLIAMLAGFASKVLVHSKPLEKSVYVVATPEGAAPAADKGAAPAG
PAPIAPLLAAASPETGQKVAKACAACHSFDKGGANKVGPNLYGIVGGPKGHIQGFSYSDA
LVKTGGSWTYDDLNKFLYDPKGYAPGTKMTFAGLKKDEDRAAVIAYLRSLADSPQPLPQ
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggagtggaacaaggttttcggcgcggtgctgctggccgggctgatcgcgatg
ctggccggattcgcgtccaaggtgctggttcattcaaagccgctggaaaagagtgtctac
gtcgtcgcgactcccgagggggccgcacccgccgccgacaagggtgccgctcccgccggc
ccggcgccgatcgcccccctgctcgccgcggccagcccggagaccggccagaaggtggcc
aaggcctgcgccgcctgccacagcttcgacaagggcggcgcgaacaaggtcggcccgaac
ctgtacggcatcgtcggcggtccgaagggccacatccagggcttcagctattccgacgcg
ctggtgaagaccggcggcagctggacctatgacgatctgaacaagttcctctacgatccc
aagggctatgcccccgggaccaagatgaccttcgccggcctgaagaaggacgaggaccgc
gccgccgtcatcgcctatctgcgctcgctggccgacagcccgcagccgctgccgcagtaa

DBGET integrated database retrieval system