KEGG   Azospirillum lipoferum 4B: AZOLI_0361Help
Entry
AZOLI_0361        CDS       T01658                                 

Gene name
dapE
Definition
Succinyl-diaminopimelate desuccinylase (SDAP)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ali  Azospirillum lipoferum 4B
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ali01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ali00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(347328..348476)
Genome map
AA seq 382 aa AA seqDB search
MTIDPIALAQDLIRCPSVTPRDDGALAVLEAALAPMGFTCHRLRFQQEGTEPVENLYARL
GTGGPNFCFAGHTDVVPPGDKGWTVDPFAGEVMGGRLFGRGAVDMKGAIAAFVAAVSRRL
QDGPPAGSISLLITGDEEGVAINGTRKVLDWMAERGERIDACVVGEPTNPKALGDMIKIG
RRGSLTGFLTVFGAQGHVAYPHLADNPLPRLVRMLAAITEHPMDEGTAHFQPSTLALTTI
DVDNTATNVIPAQGKATFNIRFNDAHTPAGIEAWLRRTFDSIGGAYELEVYCSGDSFVTP
PGPLTELVAEAVEGVTGRRPEYSTTGGTSDARFIKNVCPVVEFGLVGQTMHKVDEYCSVE
DLRRLTDIYEAILKGVFTRLAG
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgaccccatcgccctcgcccaggacctcatccgctgccccagcgtcacgccg
cgcgacgatggtgcgctggccgtgctggaggcggcgctggcgccgatgggcttcacctgc
caccgcctgcgcttccagcaggagggaacggagccggtggagaacctctatgcccggctc
ggcaccggcggtcccaatttctgcttcgccggccacaccgacgtggttccgccgggggac
aagggctggacggtcgatcccttcgccggcgaggtgatgggcggacgcctgttcggccgc
ggtgcggtggacatgaagggcgccatcgccgccttcgtcgccgccgtgtcgcgccggctg
caggacggcccgcccgccggctccatcagcctgctgatcaccggcgacgaggaaggggtg
gcgatcaacggcacccgcaaggtgctggactggatggccgagcgcggcgagcgcatcgac
gcctgcgtggtgggggagccgaccaaccccaaggctctcggcgacatgatcaagatcggc
cggcgcggcagcctgaccggcttcctgaccgtgttcggcgcgcaaggccatgtcgcttac
ccccatctggccgacaacccattgccgcggctggttcgcatgctggccgccatcaccgaa
cacccgatggacgaggggacagcgcatttccagccctccaccctggcgctgaccaccatc
gatgtcgacaacacggcgacaaacgtcattcccgcccagggcaaggcgaccttcaacatc
cgcttcaacgacgcccacaccccggccggcatcgaggcgtggctgcgccgcaccttcgat
tccatcggcggcgcctatgagttggaggtctactgctccggcgacagcttcgtcaccccg
cccggtccgctgaccgagctggtggccgaggcggtggagggggtgaccggacgccgtccc
gaatactcgaccaccggcggcacgtcggacgcccgcttcatcaagaatgtctgcccggtg
gtggagttcgggctggtcggccagaccatgcacaaggtcgacgaatattgttcggtggag
gatctccgccggctgacggacatctacgaggccatcctgaagggcgtgttcacgcgcctt
gccgggtga

DBGET integrated database retrieval system