KEGG   Azospirillum lipoferum: AZOLI_0510Help
Entry
AZOLI_0510        CDS       T01658                                 

Definition
putative lysophospholipase L2, (Lecithinase B)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
ali  Azospirillum lipoferum
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AZOLI_0510
Enzymes [BR:ali01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AZOLI_0510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
469715..470749
Genome map
AA seq 344 aa AA seqDB search
MADDAAWTASGIMPDLRHVEMRSVAMADGARLRVAVWPKPERVRGTALVLTGRAEFIEKY
AETAGALAARGFRVVAVDWRNQGLSDRPLANRQIHHLSDFALLVDDLDGVYRQVVAPVAA
ETGGPLILLAHSMGGLVATLALARHAADDPGRYAAVLLAAPMYAIHTGPLPPRLARALAC
LGLACGWGGRYALWQGDYDPAEAVFRPDNKITADPQRYAAFHTPFAERPELRVGGVSFAW
VAAALDAEDALRHGGLPLDRVRTPVLLLSAPGDRVVRAELHRMVAGRLGNAHLVEYPGAK
HELLMECDAIRDRVWADIDDFLDRTLGDGTGHKTLAQSGGSVVG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgatgccgcctggactgcatccgggatcatgccggacctgcgccatgtggag
atgcggtctgtcgcgatggccgacggggcgcggctgcgggtcgccgtctggccgaagccg
gagcgggtgcgcggcacggcgctggtgctgaccggccgggccgagttcatcgagaaatat
gcggagaccgcaggcgcgttggccgcccgcggcttccgcgtggtggcggtcgactggcgc
aaccagggcctgtcggaccggccgctggccaaccggcagatccaccatctcagcgatttc
gcgctgctggtcgacgacctcgacggcgtctaccggcaggtcgtggcgcccgtcgccgcg
gagaccggagggccgctgatcctgctggcgcattccatgggtggtctcgtggcgacgctg
gcgctggcccgccatgccgcggacgatcccggccgctatgccgccgtgctgctggcggca
ccgatgtacgccatccacaccggaccgctgccgccccggctggcgcgggcgctggcctgc
ctggggctcgcctgcggatgggggggccgctatgcgctgtggcagggcgattacgacccg
gcggaggccgtcttccggccggacaacaagatcaccgccgatccgcagcgctacgccgcc
ttccatacccccttcgccgagcggccggaactgcgcgtcggcggtgtcagcttcgcctgg
gtggcggcggcgctggatgcggaggacgcgctgcgccatggcggcctgccgctggaccgg
gtgcggacgccggtcctgctgctgagcgcgcccggcgaccgggtggtccgggcggagctt
caccgcatggtggccggccggctcggcaacgcccatctcgtcgagtatcccggagcgaag
cacgagctgctgatggaatgcgacgccatccgcgaccgggtgtgggcggacatcgacgac
ttcctcgacaggaccctcggtgacgggaccggccacaagacacttgcgcagtccggcggc
tctgtcgtcggatag

DBGET integrated database retrieval system