KEGG   Azospirillum lipoferum 4B: AZOLI_0529Help
Entry
AZOLI_0529        CDS       T01658                                 

Gene name
kdtA
Definition
3-deoxy-D-manno-octulosonic-acid transferase
Orthology
K02527  
3-deoxy-D-manno-octulosonic-acid transferase [EC:2.4.99.12 2.4.99.13 2.4.99.14 2.4.99.15]
Organism
ali  Azospirillum lipoferum 4B
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Lipopolysaccharide biosynthesis [PATH:ali00540]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
484821..486191
Genome map
AA seq 456 aa AA seqDB search
MPPGALPVFRIRRTGNAPVVVRLLFRALMLQSLYRGLTTVAGPAVRLYLDRRRAAGKEDP
VRQAERFGTPSRPRPAGPLVWIHAASVGEANSVLVLIGRLLDDASDLTVLMTTGTVTSAE
LMGRRLPERAIHQYVPVDLPDAVDRFLDHWRPDAVLWTESEIWPNLLAGIRARAIPAALV
NARMSERSFARWRNAPRFVGGLLSTFQITLAQTEGDAERLRRLGAAGVASVGNLKFSAEP
PPAAAAAMEPLRAALAGRPVWLLASSHPGEEDIAAAVHAALAPALPGLLTIIVPRHAHRG
EAVAELMGARGLPVLRRTDSHLLPGPEHAVYVADTMGELGLFYRAAPVVCMGGSFIPHGG
QNPVEPAQLGCAVIYGPHMFNFGEITHMLEAAGGALPVADGEALAREIRRLLTDDHARDR
IVAGAARVTADNRRIIDRALAALSPLLDTAGIPTAA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
gtgccgccgggcgcgctgccggtgttccgtatcaggaggaccggcaacgcgcccgttgtc
gtccgtctcctgttccgggccttgatgctgcaatccctttaccgtggcctgacgaccgtc
gccgggccggcggtgcgcctctatctcgaccgccgccgcgctgcgggcaaggaagacccc
gtgcgtcaggcggagcggttcggcacgccctcgcgcccgcggccggccggaccgctggtg
tggatccatgcggccagcgtgggcgaggcgaattcggtcctggtcctgatcggccggctt
ctggacgacgcatccgacctgaccgtgctgatgaccaccggcaccgtcacctcggcagaa
ctgatgggacggcggctgcccgagcgggcgatccaccaatatgtgccggtcgatctgccg
gatgccgtcgaccgttttctcgaccactggcgccccgacgcggtgctgtggacggaatcg
gagatctggccgaacctgctggccggcatccgcgcccgcgccatccccgccgccctggtc
aacgcccgcatgtcggagcgcagcttcgcccgctggcgcaacgcgccgcgcttcgtcggc
gggctgctgtcgaccttccagatcacgctggcccagaccgaaggcgatgcggagcggctg
cgccggctgggtgccgcgggagtcgccagcgtcggcaacctgaaattctccgccgagccg
ccgcccgccgccgccgctgcgatggagccactccgcgcggcgctggccggccggccggtc
tggctgctcgccagttcccatccgggggaggaggacatcgccgcggcggtccacgcggcg
ctggctccggctctgcccggcctgctgacgatcatcgtcccccgccatgcccatcgtggc
gaggccgttgccgagctgatgggggcgcgcggcttgccggtgctgcggcgaacggacagc
cacctgctgccggggccggagcatgccgtctatgtcgccgacacgatgggcgagctggga
ctgttctaccgcgcggccccggtggtgtgcatgggcggctccttcattccccatggcggg
cagaacccggtggagccggcgcagctgggctgcgcggtgatctacggcccgcacatgttc
aatttcggcgagatcacccacatgctggaggccgccggcggcgccctgccggtcgcggac
ggcgaggcactggcccgcgagatccggcgcctgctgaccgacgaccatgcgcgcgaccgc
atcgtcgcgggggcggcgcgggtgacggcggacaaccggcggatcatcgaccgcgcgctg
gccgcgctgtccccgctgctggacaccgccggcatcccgaccgccgcctga

DBGET integrated database retrieval system