KEGG   Azospirillum lipoferum 4B: AZOLI_0763Help
Entry
AZOLI_0763        CDS       T01658                                 

Definition
putative diguanylate cyclase, GGDEF domain
Orthology
K13590  
diguanylate cyclase
Organism
ali  Azospirillum lipoferum 4B
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
715905..716933
Genome map
AA seq 342 aa AA seqDB search
MAITEDFERSSGLAAQAMDRMLSERLPPTPENFTLWFVYFSGRNPDLTRAIDLARRDGLT
TSQTLCDELYKRFFTLDAEAQAIRETSDKARYALGRILEQLGNVGSETERYGNALTGFRD
ELDQPLSLPELRAMVAAIAAETKEIVDRQTALQFQLQESSQQLAEMRVSLDSARREALTD
GLTGIGNRKAFDLMLQEAMEASVRDEQPLCLLMVDIDHFKAFNDTHGHLVGDHVLKLVAR
MLTECIKGRDTAVRYGGEEFAIILPRTSLANATKLAEQVRSFVGARQIVNKARNANYGTV
ALSVGVAEFRAGEPAMALVRRADQALYAAKRGGRNRVMAETA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtggcgatcacggaggatttcgagcgttccagcggcctcgccgcgcaggccatggatcgg
atgctgtccgaacgactgccgcccaccccggaaaacttcacgctttggttcgtctatttc
agcggccgcaacccggacctgacccgcgccatcgatctggcgcgccgcgacgggctgacc
acgtcgcagactctgtgcgacgagctgtacaagcgcttcttcacgctcgatgccgaagcg
caggcgatccgcgaaacctccgacaaggcgcgctacgccctgggccgcatcctggagcag
ctgggcaatgtcgggtcggagacggagcgctacggcaatgccctgaccggcttccgggat
gagctggaccagccgctcagcctgccggaactgcgggcgatggtcgcggccatcgcggcg
gagaccaaggagatcgtcgatcgtcagaccgcccttcagttccagcttcaggaatcgagc
cagcaattggcggagatgcgggtcagcctggacagcgcgcggcgcgaggcgctgaccgac
gggctgaccggcatcggcaaccgcaaggccttcgacctgatgctgcaggaggcgatggag
gcatcggtgcgcgacgagcagccgctgtgcctgctgatggtcgacatcgatcatttcaag
gccttcaacgacacccacggccatctggtcggcgaccatgtgctgaagctggtcgcccgc
atgctgaccgaatgcatcaagggccgcgacaccgccgtccgctatggcggggaggagttc
gcgatcatcctgccgcgcaccagcctggcgaacgccaccaagctggccgagcaggtgcgc
agcttcgtcggcgcccggcagatcgtgaacaaggcgcgcaacgccaattacggcaccgtc
gccctgtcggtcggcgtcgccgaattccgtgccggtgagccggcgatggcgctggtccgg
cgcgccgatcaggccctctatgccgccaagcgcggcggccgcaaccgggtgatggcagaa
accgcctga

DBGET integrated database retrieval system