KEGG   Azospirillum lipoferum: AZOLI_0796Help
Entry
AZOLI_0796        CDS       T01658                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ali  Azospirillum lipoferum
Pathway
ali00260  Glycine, serine and threonine metabolism
ali00750  Vitamin B6 metabolism
ali01100  Metabolic pathways
ali01110  Biosynthesis of secondary metabolites
ali01120  Microbial metabolism in diverse environments
ali01230  Biosynthesis of amino acids
Module
ali_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AZOLI_0796 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AZOLI_0796 (thrC)
Enzymes [BR:ali01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AZOLI_0796 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP Bcl-2
Motif
Other DBs
NCBI-ProteinID: CBS86145
UniProt: G7Z3Y5
Position
749000..750421
Genome map
AA seq 473 aa AA seqDB search
MRYVSTRGAAPVLGFEDVLLAGLARDGGLYVPETWPQFTADDIRAMRGLPYSEIAVRVML
PFLGGSIAEDEFRAIVRDAYASFDHAAVTPLVQVDPTTWVLELFHGPTLAFKDVALQLLG
RLFDHVLAKRGQRVTIVGATSGDTGSAAIEACRDRQNVDIFILHPKGRTSEVQRRQMTSV
LSSNVHNIALDGTFDDCQDLVKAMFNDGAFRDRMGLSAVNSINWARIMAQIVYYFTAAVA
LGAPDRKIASTVPTGNFGNVYAAYGARAMGLPVETLVVGSNSNDILARFFASGSMVAAPV
VPTLSPSMDIQISSNFERLLFDLLDRDGNAVTEALNRFRAEGKFAVTDAQLARALAIFSG
HRVDEAATMATIADVWKGSLYLLDPHTAVGIGAAKAAVAAGRVDPSVPMVVLATAHPAKF
PDAVEKATGRRPELPPRLSDLYVREERLSELPNDLAAVQDFVIARARAAQEAA
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
gtgcggtacgtcagcacgcggggcgcggccccggtcttgggtttcgaagacgtccttctt
gccgggctggcgcgcgacggcggcctctatgtgccggaaacctggccgcagttcacggcc
gacgacatccgcgccatgcgcggtctgccctacagcgagatcgccgtccgcgtgatgctg
cccttcctggggggatcaatcgccgaggacgagttccgcgccatcgtccgcgatgcctat
gccagcttcgaccacgccgcggtgaccccgctggtgcaggtcgatccgactacctgggtg
ctggagctgttccacggtccgacgctggccttcaaggatgtggcgctgcaactgctcggc
cgcctgttcgatcatgtgctggccaagcgcgggcagcgggtgaccatcgtcggcgccacc
tccggcgacaccggatcggccgccatcgaggcctgccgcgaccgccagaacgtcgacatc
ttcatcctgcatcccaagggccgcacgtccgaggtgcagcgccggcagatgaccagcgtg
ctgtcgtccaacgtccacaacatcgcgctggacggcaccttcgacgattgccaggacctc
gtgaaggcgatgttcaacgacggcgccttccgcgaccggatggggctgtcggcggtgaac
tcgatcaactgggcccgtatcatggcccagatcgtctattacttcaccgccgcggtggcg
ttgggcgcgcccgaccggaagatcgcctccaccgtgccgaccggcaatttcggcaacgtc
tatgccgcctatggcgcccgcgccatggggctgccggtggagacgctggtggtcggctcc
aacagcaacgacatcctggcgcgctttttcgccagcgggagcatggtcgcggcgcccgtc
gtgcctaccttgtctcccagcatggacatccagatctcttccaacttcgaacggctgctg
ttcgacctgctcgaccgcgacggcaatgcggtgacggaggcgctgaaccgcttccgcgcc
gagggcaagttcgcggtgaccgacgcgcagctcgcccgcgcgctggccatcttctccggc
caccgggtggacgaggccgccacgatggcgaccatcgccgatgtctggaagggcagcctc
tatctgctcgacccgcacaccgcggtcggcatcggggcggccaaggccgcggtcgcggcc
ggccgggtcgatccgtccgttcccatggtggttctcgccaccgcccatcccgccaagttc
cccgacgcggtggaaaaggcgaccggccgccggccggagctgccgccgcgcctgtccgat
ctttatgtgcgcgaggagcgcctgtccgaactgccgaacgatctggcggcggttcaggac
ttcgtcatcgcgcgcgcccgcgccgcccaggaggccgcatga

DBGET integrated database retrieval system