KEGG   Azospirillum lipoferum: AZOLI_0826Help
Entry
AZOLI_0826        CDS       T01658                                 

Gene name
ruvA
Definition
(GenBank) Holliday junction DNA helicase ruvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ali  Azospirillum lipoferum
Pathway
ali03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ali00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AZOLI_0826 (ruvA)
Enzymes [BR:ali01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     AZOLI_0826 (ruvA)
DNA repair and recombination proteins [BR:ali03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AZOLI_0826 (ruvA)
    RecFOR pathway proteins
     AZOLI_0826 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH Goodbye
Motif
Other DBs
NCBI-ProteinID: CBS86171
UniProt: G7Z9L9
Position
774640..775266
Genome map
AA seq 208 aa AA seqDB search
MIAKLTGIVDSTGTDWVVLDVNGVGYLLSCSNRTLSRMAVGERVSLVVETFIREERIVLH
GFGDQAEREWFKLLTTIQGVGARLALSILGVLDPDQLTRAIASQDKTALVRADGVGPKVA
ARILNELKDKVGNLALGPAATVGAPAGKGAPAAVPGASPALADAVSALVNLGYGRSEAFG
AVVAAGRVLGDDAGVSDLIRQGLKELSQ
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccaagctgaccggcatcgtcgattccaccggcaccgactgggtcgtgctcgac
gtgaacggagtcggttacctgctgtcctgctccaaccgcacgctgtcgcgcatggcggtg
ggcgagcgcgtgtcgttggtggtggagaccttcatccgcgaggagcgcatcgtcctgcac
ggcttcggcgatcaggcggaacgggagtggttcaagctgctgaccaccatccagggcgtc
ggtgcccggctggcgctgtcgatcctcggcgtgctcgaccccgaccagctgacgcgcgcc
atcgcgtcgcaggacaagaccgcgctggtgcgcgccgacggcgtcgggccgaaggtggcg
gcgcgcatcctgaacgaactcaaggacaaggtcggcaatctggcgctcggccccgcggcg
accgtgggcgcgccggccggcaagggcgcccccgccgccgtgcccggcgccagcccggcg
ctggccgacgcggtgtcggcgctggtcaatctcggctatggccggtcggaggccttcggc
gcggtcgtcgccgccgggcgcgtgctgggcgatgacgccggcgtgtccgatctgatccgc
cagggcctcaaggaactgagccaatga

DBGET integrated database retrieval system