KEGG   Azospirillum lipoferum: AZOLI_1110Help
Entry
AZOLI_1110        CDS       T01658                                 

Gene name
hemB
Definition
Delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ali  Azospirillum lipoferum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AZOLI_1110 (hemB)
Enzymes [BR:ali01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     AZOLI_1110 (hemB)
Exosome [BR:ali04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AZOLI_1110 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1048808..1049824)
Genome map
AA seq 338 aa AA seqDB search
MVFPMPISLPAAFPRTRLRRNRADAWTRRLVAENTLTVDDLIWPVFVIEGENHREPVASM
PGVERLTIDLLCEAVASAGALGIPCIALFPVVGSDAKSEDAAESYNPENLMNRAIRAVKA
AAPEVGILGDVALDPYTSHGHDGLMRDGYIQNDETVEVLVRQALSQAEAGCDIVAPSDMM
DGRIGAIRDALDRDGHQLTRVCSYAAKYASAFYGPFRDAVNSGGFLKGDKTTYQMNPANT
DEALREVACDLQEGADMVMVKPGLPYLDIIRRVKDQFAVPTFAYHVSGEYAMLRAASANG
WLNYDKALLETLMGFKRAGCDAILTYGAVDAAKLLRQG
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggtcttcccgatgccgatctccctccccgccgccttcccgcgcacccgtctgcgccgc
aaccgcgccgatgcctggacccgccgtctggtcgccgagaacacgctgaccgtcgacgac
ctgatctggccggtcttcgtgatcgagggcgagaaccatcgggagcccgtagcctccatg
cccggcgtggagcgcctgaccatcgacctgctgtgcgaggcggtggcgtccgccggcgcg
ctcggcattccctgcatcgccctgttcccggtcgtcggctccgatgccaagtcggaggac
gcggcggaatcctacaaccccgagaacctgatgaaccgcgccatccgcgcggtgaaggcg
gcggcgccggaggtcgggattctcggcgacgtggcgctcgacccctacaccagccacggc
catgacggcctcatgcgcgacggctacatccagaacgatgagacggtggaggttctggtc
cgccaggccctgtcgcaggcagaggccggctgcgacatcgtcgccccgtcggacatgatg
gacggccgcatcggcgcgatccgcgacgcgctcgaccgggacggccatcagctgacccgc
gtctgctcctatgcagccaaatacgcgtcggccttctacggccccttccgcgacgcggtg
aactccggcggcttcctgaagggcgacaagaccacctaccagatgaacccggccaacacc
gacgaggccctgcgcgaggtcgcctgcgacctgcaggaaggggcggacatggtgatggtg
aagccgggcctgccctatctcgacatcatccgccgggtgaaggaccagttcgcggttccg
accttcgcctatcatgtatcgggcgaatacgcgatgctgcgcgccgcctcggccaatggc
tggctgaactacgacaaggccctgctggagaccctgatgggcttcaagcgcgccggctgc
gatgccatcctgacctatggcgcggtggacgccgcgaagctgctcaggcagggctga

DBGET integrated database retrieval system