KEGG   Azospirillum lipoferum 4B: AZOLI_1161Help
Entry
AZOLI_1161        CDS       T01658                                 

Definition
Acireductone dioxygenase ARD
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ali  Azospirillum lipoferum 4B
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:ali00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1106919..1107482)
Genome map
AA seq 187 aa AA seqDB search
MSHLTVYLENDARRPELSTSDPDLMAGHLAHVGIMFERWTADTPLPASADGEAVLAAYAQ
PVEALKAARRFRAVDVVRVTPATEGVAALRAKFLDEHTHDEDEARFFVEGAGAFYIHLDR
RVLRVVCEAGDLLSIPAGTPHWFDMGPRPRFTTIRFFTRPDGWIASPTGDTIAARFPLFE
PATVDAA
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
ttgagtcacctgaccgtctatctggagaacgacgcccggcggccggaattgagcacgtcc
gaccctgatttgatggccgggcatctggcccatgtcggcatcatgttcgaacgctggact
gccgacacccccctgcccgcctccgccgacggcgaggcggtgctggcggcctacgcccag
ccggtcgaggcgttgaaggcggcgcgccgcttccgcgccgtcgacgtggtgcgggtcacg
ccggcaaccgagggcgtggcagccctgcgcgccaaattcctggacgagcacacccatgac
gaggacgaggcgcgattcttcgtcgaaggggccggcgccttctacatccatctcgaccgc
agggtcttgcgcgtggtgtgcgaggcgggtgacctgctgagcatccccgccggcacgccg
cactggttcgacatggggccgcgcccccgcttcaccaccatccgcttctttacgcggccg
gacggctggatcgccagcccgaccggcgacaccatcgccgcacgcttccccctgttcgaa
ccggcgacggtggacgcggcctga

DBGET integrated database retrieval system