KEGG   Azospirillum lipoferum: AZOLI_1222Help
Entry
AZOLI_1222        CDS       T01658                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ali  Azospirillum lipoferum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AZOLI_1222 (tpiA)
   01230 Biosynthesis of amino acids
    AZOLI_1222 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZOLI_1222 (tpiA)
   00051 Fructose and mannose metabolism
    AZOLI_1222 (tpiA)
   00562 Inositol phosphate metabolism
    AZOLI_1222 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AZOLI_1222 (tpiA)
Enzymes [BR:ali01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AZOLI_1222 (tpiA)
Exosome [BR:ali04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AZOLI_1222 (tpiA)
  Exosomal proteins of bladder cancer cells
   AZOLI_1222 (tpiA)
  Exosomal proteins of melanoma cells
   AZOLI_1222 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1165884..1166639
Genome map
AA seq 251 aa AA seqDB search
MTARRKLIAGNWKMNGLKADGLDLASDLAGRLKGAGPVAFDMLVCPPFPLLFPVGEAIAD
SPLALGGQDCAPKTSGAHTGDVAPTMLKDAGCRFVILGHSERRADHGESDSMVNAKAVAA
HKEGLVAIVCVGETEAQRDAGQADAVVSGQLAGSIPAGATAENTVIAYEPVWAIGTGKTA
TPDDVKAMHAHIRAELAGKIADPDKVRILYGGSVKPGNAAELMAVENVDGALVGGASLKA
DDFWGIATACR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaagacggaagctgatcgccggaaactggaagatgaacgggttgaaggccgac
gggctggatctcgcctccgaccttgccgggcggctgaagggcgccggcccggtcgccttc
gacatgctggtctgcccgcccttcccgctgctgttcccggtgggggaggcgattgccgac
agcccgctggcgctgggcggccaggattgcgcgcccaagacctccggcgctcacaccggc
gacgtggccccgaccatgctgaaggatgccggctgccgcttcgtcatcctcggccattcg
gagcgccgcgccgaccatggcgagagtgattccatggtcaacgccaaggccgtcgccgcc
cataaggagggtctggtcgccatcgtctgcgtcggcgagacggaggcgcagcgcgatgcc
ggacaagccgacgccgtggtgtcgggccagctcgccggctccatccccgccggtgcgact
gcggagaacaccgtcatcgcctatgagccggtctgggccatcggcaccggcaagaccgcg
actccggacgatgtgaaggcgatgcacgcccatatccgggccgagctggccggcaagatc
gccgatccggacaaggtgcgcatcctctacggcggttcggtcaagccgggcaatgcggcg
gagttgatggcggtggagaatgtcgacggcgcgctggtcggcggtgcgtcgctgaaggcc
gacgatttctggggcatcgcaaccgcctgccgttga

DBGET integrated database retrieval system