KEGG   Azospirillum lipoferum: AZOLI_1331Help
Entry
AZOLI_1331        CDS       T01658                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase, dihydrolipoamide acetyltransferase (E2) component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ali  Azospirillum lipoferum
Pathway
ali00010  Glycolysis / Gluconeogenesis
ali00020  Citrate cycle (TCA cycle)
ali00620  Pyruvate metabolism
ali01100  Metabolic pathways
ali01110  Biosynthesis of secondary metabolites
ali01120  Microbial metabolism in diverse environments
ali01130  Biosynthesis of antibiotics
ali01200  Carbon metabolism
Module
ali_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZOLI_1331 (pdhC)
   00020 Citrate cycle (TCA cycle)
    AZOLI_1331 (pdhC)
   00620 Pyruvate metabolism
    AZOLI_1331 (pdhC)
Enzymes [BR:ali01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AZOLI_1331 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N RnfC_N GCV_H
Motif
Other DBs
NCBI-ProteinID: CBS86640
UniProt: G7Z4Y1
Position
1259409..1260755
Genome map
AA seq 448 aa AA seqDB search
MTVQILMPALSPTMTEGNLAKWLKKEGDTVKSGDVLAEIETDKATMEVEAVDEGRIGKIL
IPAGSQGVAVNTPIAILLEEGEDESALASAGSAPAAAPAQAAAPAAAPAPAAAPAAAAPA
PAAAPAAAPAASGERVFASPLARRIAEQAGVDLKTVKGSGPHGRIVKADVEAAKAAGPAK
AAVAPAAAPAPTAAAPVPAAAPAPAPKAEGVDAKALADKLGMAYTAVPNSGMRKTIAKRL
GEVKRTVPDYFLTVDVEIDALMKVRAELNGRSDAYKLSVNDFIIRAVALALKKVPAINAA
WTDEAMLQFQHADVSVAVATPTGLITPIVKKAETKGLADISNEMKALAKKARDNALKPEE
YQGGTISISNLGMMGIKQFQAIINPPQACILAVGASEQRPVVKDGALAIATVMSLTGTFD
HRVADGAVGAEFLAAVKKLLEDPLSMLL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttcagattctgatgcccgccctctcgcccacgatgaccgagggcaacctcgcc
aagtggctgaagaaggaaggcgacacggtgaagtccggcgacgtgctcgccgagatcgag
accgacaaggccaccatggaagtcgaagcggtcgatgaaggccgcatcggcaagatcctg
atcccggccggcagccagggcgtggcggtgaacacccccatcgccatcctgctggaagag
ggcgaggacgagagcgcgctggcttcggccggatccgctccggccgctgctcctgcccag
gccgctgcgcctgccgcggctcccgctccggcggctgccccggccgccgcggctccggcc
cccgccgccgctccggctgctgccccggcggcttcgggcgagcgcgtgttcgccagcccg
ctggcgcgccgcatcgccgaacaggccggcgtcgacctgaagaccgtcaagggcagcggc
ccgcacggccgcatcgtcaaggccgacgtggaggccgccaaggccgccggtccggccaag
gccgcggtcgctccggctgccgccccggctccgaccgccgccgctccggttcccgccgcg
gctccggccccggcgcccaaggccgagggtgtggatgccaaggcgctcgccgacaagctg
ggcatggcctacaccgccgttcccaacagcggcatgcgcaagaccatcgccaagcgcctg
ggcgaggtgaagcgcaccgtccccgactatttcctgacggtggatgtcgagatcgacgcg
ctgatgaaggtccgcgccgagctgaacgggcgttccgacgcctacaagctgtcggtgaac
gacttcatcatccgtgccgtcgcgctggcgctgaagaaggtcccggcgatcaacgccgcc
tggaccgacgaggcgatgctgcagttccagcatgccgacgtgtcggttgccgtcgccacc
ccgaccgggctgatcaccccgatcgtcaagaaggcggagaccaagggtctggccgacatc
tccaacgagatgaaggcgctggccaagaaggcgcgcgacaacgcgctgaagccggaagag
tatcagggcggcaccatctccatctccaacctgggcatgatggggatcaagcagttccag
gcgatcatcaacccgccgcaggcctgcatcctggcggtcggcgccagcgagcagcgcccg
gtggtgaaggacggcgctctggccatcgccacggtgatgagcctgaccggcaccttcgac
caccgcgtggccgatggcgccgtcggtgcggaattccttgcggcggtgaagaagctgctc
gaggatccgctctcgatgctgctctga

DBGET integrated database retrieval system