KEGG   Azospirillum lipoferum: AZOLI_1428Help
Entry
AZOLI_1428        CDS       T01658                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ali  Azospirillum lipoferum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AZOLI_1428
   01230 Biosynthesis of amino acids
    AZOLI_1428
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZOLI_1428
   00030 Pentose phosphate pathway
    AZOLI_1428
   00051 Fructose and mannose metabolism
    AZOLI_1428
   00052 Galactose metabolism
    AZOLI_1428
  Energy metabolism
   00680 Methane metabolism
    AZOLI_1428
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    AZOLI_1428
Enzymes [BR:ali01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AZOLI_1428
Protein phosphatases and associated proteins [BR:ali01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AZOLI_1428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1351375..1352469)
Genome map
AA seq 364 aa AA seqDB search
MTAPTKAGKRIGILTSGGDCAGLNAVIRAVVHRATGYGWQVLGIKEGTQGLLQRPVQYQT
LDLGSVDGHMMRQGGTILGTTNRGDPFAYPMPDGTLKDRSDEIIGGYRELGLDALIGIGG
DGSFAILHKLAQKGGFPMVGVPKTIDNDLGKTEVSVGYDTAVAVAVEALDRLQPTAASHH
RVMVLEVMGRDAGHIALAAGIAGGADVILIPEIPYSIESIAAKIQDVRNTGRNFALVVVS
EAVKTLEGTGVKKVLQGGEKRYGGIGDYIGEKIADATGAETRVTVLGHVQRGSMPSPRDR
LIASAFGVHAVDLIAEGKFNRMVAWSNRGVIDVPITEAIEHYSCVELDGALVKTARGLNI
SFGD
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgactgccccaacgaaagccggcaagcgcatcggcatcctgaccagcggcggcgactgc
gccgggctgaacgccgtcatccgcgcggtggtccaccgcgccaccggctatggctggcag
gtgctgggaatcaaggaaggcacccagggcctgctgcagcgcccggtgcagtaccagacg
ctcgacctcggctccgtcgacggccacatgatgcgccagggcggcaccatcctgggcacg
accaaccgcggcgaccccttcgcctatccgatgcccgacggcacgctgaaggaccggtcg
gacgagatcatcggcggctaccgcgaactcggcctggacgccctgatcggcatcggcggc
gacggcagcttcgccatcctgcacaagctggcgcagaagggcggcttcccgatggtgggc
gtgcccaagaccatcgacaacgacctgggcaagaccgaggtgtccgtcggctacgacacc
gccgtcgccgtggcggtggaggcgctcgaccgcctgcagcccaccgccgccagccaccac
cgcgtcatggtgctggaggtgatgggccgcgacgccggccacatcgcgctggcggccggc
atcgccggcggggccgacgtgatcctgatcccggaaatcccctattccatcgagagcatc
gcggccaagatccaggatgtccgcaacaccggccgcaacttcgccctcgtcgtggtgtcg
gaggcggtgaagacgctggagggcaccggcgtcaagaaggtgctgcagggcggcgagaag
cgctatggcggcatcggcgactatatcggcgagaagatcgccgacgccaccggggcggag
acccgcgtcaccgttctgggccatgtccagcgcggcagcatgcccagcccgcgcgaccgg
ctgatcgcgtcggccttcggcgtccacgccgtcgacctgatcgcggagggcaagttcaac
cgcatggtcgcctggtcgaatcgcggcgtcatcgacgtgccgatcaccgaggcgatcgag
cattactcctgcgtcgagctggacggggcgctggtcaagaccgcccgcggcctgaacatc
agcttcggcgattga

DBGET integrated database retrieval system