KEGG   Azospirillum lipoferum: AZOLI_1428Help
Entry
AZOLI_1428        CDS       T01658                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ali  Azospirillum lipoferum
Pathway
ali00010  Glycolysis / Gluconeogenesis
ali00030  Pentose phosphate pathway
ali00051  Fructose and mannose metabolism
ali00052  Galactose metabolism
ali00680  Methane metabolism
ali01100  Metabolic pathways
ali01110  Biosynthesis of secondary metabolites
ali01120  Microbial metabolism in diverse environments
ali01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZOLI_1428
   00030 Pentose phosphate pathway
    AZOLI_1428
   00051 Fructose and mannose metabolism
    AZOLI_1428
   00052 Galactose metabolism
    AZOLI_1428
  Energy metabolism
   00680 Methane metabolism
    AZOLI_1428
Enzymes [BR:ali01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AZOLI_1428
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     AZOLI_1428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: CBS86732
UniProt: G7Z526
Position
complement(1351375..1352469)
Genome map
AA seq 364 aa AA seqDB search
MTAPTKAGKRIGILTSGGDCAGLNAVIRAVVHRATGYGWQVLGIKEGTQGLLQRPVQYQT
LDLGSVDGHMMRQGGTILGTTNRGDPFAYPMPDGTLKDRSDEIIGGYRELGLDALIGIGG
DGSFAILHKLAQKGGFPMVGVPKTIDNDLGKTEVSVGYDTAVAVAVEALDRLQPTAASHH
RVMVLEVMGRDAGHIALAAGIAGGADVILIPEIPYSIESIAAKIQDVRNTGRNFALVVVS
EAVKTLEGTGVKKVLQGGEKRYGGIGDYIGEKIADATGAETRVTVLGHVQRGSMPSPRDR
LIASAFGVHAVDLIAEGKFNRMVAWSNRGVIDVPITEAIEHYSCVELDGALVKTARGLNI
SFGD
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgactgccccaacgaaagccggcaagcgcatcggcatcctgaccagcggcggcgactgc
gccgggctgaacgccgtcatccgcgcggtggtccaccgcgccaccggctatggctggcag
gtgctgggaatcaaggaaggcacccagggcctgctgcagcgcccggtgcagtaccagacg
ctcgacctcggctccgtcgacggccacatgatgcgccagggcggcaccatcctgggcacg
accaaccgcggcgaccccttcgcctatccgatgcccgacggcacgctgaaggaccggtcg
gacgagatcatcggcggctaccgcgaactcggcctggacgccctgatcggcatcggcggc
gacggcagcttcgccatcctgcacaagctggcgcagaagggcggcttcccgatggtgggc
gtgcccaagaccatcgacaacgacctgggcaagaccgaggtgtccgtcggctacgacacc
gccgtcgccgtggcggtggaggcgctcgaccgcctgcagcccaccgccgccagccaccac
cgcgtcatggtgctggaggtgatgggccgcgacgccggccacatcgcgctggcggccggc
atcgccggcggggccgacgtgatcctgatcccggaaatcccctattccatcgagagcatc
gcggccaagatccaggatgtccgcaacaccggccgcaacttcgccctcgtcgtggtgtcg
gaggcggtgaagacgctggagggcaccggcgtcaagaaggtgctgcagggcggcgagaag
cgctatggcggcatcggcgactatatcggcgagaagatcgccgacgccaccggggcggag
acccgcgtcaccgttctgggccatgtccagcgcggcagcatgcccagcccgcgcgaccgg
ctgatcgcgtcggccttcggcgtccacgccgtcgacctgatcgcggagggcaagttcaac
cgcatggtcgcctggtcgaatcgcggcgtcatcgacgtgccgatcaccgaggcgatcgag
cattactcctgcgtcgagctggacggggcgctggtcaagaccgcccgcggcctgaacatc
agcttcggcgattga

DBGET integrated database retrieval system