KEGG   Azospirillum lipoferum: AZOLI_1563Help
Entry
AZOLI_1563        CDS       T01658                                 

Definition
(GenBank) Protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ali  Azospirillum lipoferum
Brite
Enzymes [BR:ali01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     AZOLI_1563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 RrnaAD Methyltransf_11 Methyltransf_23 PrmA Methyltransf_32 Methyltransf_18
Motif
Other DBs
NCBI-ProteinID: CBS86860
UniProt: G7Z7D6
Position
complement(1494435..1495091)
Genome map
AA seq 218 aa AA seqDB search
MTDFAAARYFMVEGQIRPNKVTDHRLVDVLSELPREAFVPESARGVAYVDDDLPIGKGRF
LLEPMVFARMLQAVAVQETDRVLDVGAAGGYSTAVLGRLATSVIGLDCDEGLTAAATAAL
AGQGIANAKAVTGPLAEGYAQNAPYDVIVVEGTVPEVPAALTEQLAEGGRLVAVVQGSGS
VGEVRLFQRTAGIVSSRILFEAKPHALPGFEKKASFVF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttcgccgccgcacgctatttcatggtcgagggacagatccgccccaacaag
gtgacggatcatcgtctcgtcgatgtcctgtcggagcttccgcgcgaagccttcgtacct
gagtcggcgcgcggcgtcgcttatgtcgacgacgatcttcccatcggcaagggccgcttc
ctgctggagccgatggtgttcgcccgcatgctgcaggcggtcgccgtgcaggagaccgac
cgggtgctcgacgtcggtgcggccggcggctattccaccgcggtgctgggccgtctggcc
acctcggtgatcggcctcgactgcgacgaggggctgaccgccgccgcgaccgcggcgctg
gccgggcagggcatcgccaatgccaaggccgtcaccggcccgctggcggaggggtacgcc
caaaacgccccttacgatgtgatcgtcgtcgaaggtaccgtgccggaggtgccggcggca
ctgaccgaacagctggccgaaggcggacgcctcgtcgcggtggttcagggcagcggcagc
gtcggggaggtccgcctgttccagcgcaccgccggaatcgtgtccagccgcatcctgttc
gaagccaagccgcatgcgctgccgggcttcgaaaagaaggcgtctttcgtgttctga

DBGET integrated database retrieval system