KEGG   Azospirillum lipoferum: AZOLI_2412Help
Entry
AZOLI_2412        CDS       T01658                                 

Gene name
proB
Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ali  Azospirillum lipoferum
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AZOLI_2412 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AZOLI_2412 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    AZOLI_2412 (proB)
Enzymes [BR:ali01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     AZOLI_2412 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2266312..2267451
Genome map
AA seq 379 aa AA seqDB search
MALDAPTLLESRRLVVKIGSALLVDGETRQIRRDWLDALADDVAACRKRGQEVVIVTSGA
VACGREHLGLVGRALKLEEKQAAAATGQIRLAHAYQETLARHDVTVAQVLVTLEDTEERR
RHLNARNTIDTLLKLGAVPVINENDTVATAEIRFGDNDRLAARVAQMVSADTLVLLSDID
GLYTADPRKDPDARHIPTVRELTPEIEGMAGEPPPGYSSGGMVTKIAAARVALSAGCRMV
IAKGKRMNPLAALEQRPEDGGALCTWFLPSAEPTSARKAWIAGHVNATGVLVVDDGAMRA
LSHGASLLPAGVTAVQGEFDRGDVVIVRTQEGREVARGLVAYSADDARKILRHKSTEIPE
ILGYRGRDEMIHRDDLVVR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttgacgcccctacccttctcgaatcccgccggctggtcgtgaagatcggctcg
gcccttctggtcgatggtgaaacccggcaaatccgccgggactggctcgacgcgctggcc
gacgacgtcgccgcctgccgcaagcgcggacaggaggtggtgatcgtcacctccggcgcc
gtcgcctgcgggcgggagcatctcggcctcgtcggccgggcgctgaagctggaggagaag
caggccgccgccgccaccggccagatccgccttgcccacgcctatcaggaaacgctggcc
cgccacgacgtcaccgtcgcccaggtgctggtgaccctggaggacacggaagaacgtcgg
cgccacctgaacgcccgcaacaccatcgataccctgctgaagttgggcgccgttcccgtc
atcaacgagaacgacacggtcgctaccgcggaaatccgtttcggcgacaatgaccggctg
gccgcccgcgtggcgcagatggtcagcgccgacacgctggttctgctgtcggacatcgac
ggcctctacacagccgacccgcgcaaggacccggacgcgcgccacatccccaccgtgcgc
gaactgacgccggagatcgagggcatggccggcgagccgccccccggctacagcagcggc
ggcatggtgaccaagatcgccgcggcgcgcgtcgccctgtcggccggctgccgcatggtc
atcgccaagggcaagcgcatgaacccgctggcggcgctggaacagcggccggaggatggc
ggtgcgctctgcacctggttcctgccctcggccgaacccaccagcgcccgcaaggcctgg
atcgccggccatgtcaacgccacgggcgtgctggtggtcgatgacggcgccatgcgcgcc
ctgtcccacggcgccagcctgctgccggccggcgtcaccgccgtgcagggcgaattcgac
cgcggcgacgtggtgatcgtccgcacccaggaagggcgcgaggtcgctcgcggcttggtc
gcctacagcgccgacgacgcccgcaagatcctgcgccacaagagcaccgagattccggag
atcctgggctatcggggacgcgacgagatgatccaccgcgacgatctggtggtgcggtga

DBGET integrated database retrieval system