KEGG   Azospirillum lipoferum: AZOLI_2526Help
Entry
AZOLI_2526        CDS       T01658                                 

Gene name
acsA
Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ali  Azospirillum lipoferum
Pathway
ali00010  Glycolysis / Gluconeogenesis
ali00620  Pyruvate metabolism
ali00640  Propanoate metabolism
ali00680  Methane metabolism
ali01100  Metabolic pathways
ali01110  Biosynthesis of secondary metabolites
ali01120  Microbial metabolism in diverse environments
ali01130  Biosynthesis of antibiotics
ali01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZOLI_2526 (acsA)
   00620 Pyruvate metabolism
    AZOLI_2526 (acsA)
   00640 Propanoate metabolism
    AZOLI_2526 (acsA)
  Energy metabolism
   00680 Methane metabolism
    AZOLI_2526 (acsA)
Enzymes [BR:ali01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AZOLI_2526 (acsA)
Lipid biosynthesis proteins [BR:ali01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AZOLI_2526 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N PQQ_2
Motif
Other DBs
NCBI-ProteinID: CBS87729
UniProt: G7Z2X5
Position
complement(2388442..2390382)
Genome map
AA seq 646 aa AA seqDB search
MTDNSLFPVKPEIAATAHVNAEAYARMYEQSVKDPEAFWGEQGKRLDWIKPYSKVKDVNF
NDDVHIRWFYDGTLNVSANCIDRHLATRGDQTAILFEGDDPGVSKAITYKELHEKVCRLA
NVLKKNGVKKGDRVTIYLPMIPEAAYAMLACTRIGAVHSIVFGGFSPDSLKDRIVDCDSH
FVITSDEGLRGGRKVPLKANADKAVAGAPTVKHVLVVKHTGGTVAWTEGRDLWYHEEMDS
VSADCPPEEMSAEDPLFILYTSGSTGKPKGVLHTTGGYLVYASMTHQYVFDYKDGEVYWC
TADVGWVTGHSYIVYGPLANGATTLMFEGVPTYPDSSRFWQVIDKHKVNIFYTAPTAIRS
LMREGEGPVKKTSRASLRVLGSVGEPINPEAWLWYYNVVGDARCPIVDTWWQTETGGILI
TPLIGAIGQKPGSATKPFFGVQPVVVDNEGQILEGETEGNLCIADAWPGMMRTVFGDHER
FVQTYFSTFPGKYFTGDGCRRDADGYYWITGRVDDVINVSGHRMGTAEVESALVAHPKVA
EAAVVGYPHDLKGQGIYAYVTLNAGETPTEELRKELVAWVRKEIGPIASPDLIQWAPGLP
KTRSGKIMRRILRKIAANEHDSLGDTSTLADPGVVTDLIDNRMNNA
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgaccgataacagcttgtttccggtgaagcccgagatcgcggcgaccgcccacgtgaat
gcggaagcctatgcccgcatgtacgagcagtcggtcaaggaccccgaggccttctggggc
gagcagggcaagcggctcgactggatcaagccctacagcaaggtaaaggacgtcaatttc
aacgacgacgttcacatccgctggttctatgacggcacgctgaatgtttcggccaactgc
atcgaccgtcacctggcgacccgcggcgaccagaccgccatcctgttcgaaggcgacgac
cccggcgtctccaaggccatcacctacaaggaactgcacgagaaggtctgccgtctcgcc
aatgtcctgaagaagaacggcgtcaagaagggcgaccgcgtcaccatctacctgccgatg
atcccggaggcggcctatgcgatgctggcctgcacccgcatcggtgccgtccactccatc
gtcttcggcggcttctcgcccgacagcctgaaggaccgcatcgtcgactgcgacagccat
ttcgtcatcacctccgacgagggcctgcgcggcggccgcaaggtgccgctgaaggccaac
gccgacaaggcagtggccggcgcgccgacggtcaagcatgtgctggtcgtcaagcacacc
ggcggcaccgtcgcatggaccgagggtcgcgacctctggtatcatgaagagatggacagc
gtctccgccgactgcccgccggaggagatgagcgccgaggatccgctgttcatcctctac
acctccggttcgaccggcaagccgaagggcgtgctgcacaccaccggcggctatctcgtc
tatgcgtcgatgacccaccagtatgtcttcgactacaaggacggcgaggtctactggtgc
acggccgacgtgggctgggtcaccggccacagctacatcgtctacggcccgctcgccaac
ggcgcgacaacgctgatgttcgaaggcgtgcccacctatccggactcctcgcgcttctgg
caggtcatcgacaagcacaaggtcaacatcttctacaccgcccccaccgccatccgctcg
ctgatgcgcgagggcgaaggcccggtgaagaagacctcgcgcgcctcgctccgcgtcctg
ggttcggtcggcgagccgatcaatccggaagcctggctgtggtactacaatgtggtcggc
gatgcccgctgcccgatcgtcgacacctggtggcagacggagaccggcggtatcctgatc
accccgctgatcggcgccatcggccagaagccgggctcggcgaccaagccgttcttcggt
gtccagccggtcgtcgtcgacaacgaaggccagatcctggaaggcgagaccgagggcaac
ctctgcatcgccgacgcatggcccggcatgatgcgcacggtgttcggcgaccacgagcgt
ttcgtccagacctacttctcgaccttcccgggcaagtacttcaccggtgacggctgccgc
cgcgacgccgacggctattactggatcaccggccgcgtcgacgacgtcatcaacgtgtcc
ggccaccgcatgggcaccgccgaggtcgaaagcgcgctggtcgcccacccgaaggtcgcc
gaggccgcggtcgtcggctatccgcacgacctgaagggccagggcatctacgcctatgtc
acgctgaacgccggcgagaccccgacggaagagctgcgcaaggaactggtcgcctgggtc
cgcaaggagatcggcccgatcgcctcgcccgacctgatccagtgggctcccggcctgccg
aagacccgttcgggcaagatcatgcgccgcatcctgcgcaagatcgccgcgaacgagcat
gacagcctgggcgacacctccacgctggccgatccgggcgtggtgacggacctgatcgac
aaccgcatgaacaacgcgtga

DBGET integrated database retrieval system