KEGG   Azospirillum lipoferum: AZOLI_2635Help
Entry
AZOLI_2635        CDS       T01658                                 

Gene name
recR
Definition
Recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ali  Azospirillum lipoferum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ali00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AZOLI_2635 (recR)
DNA repair and recombination proteins [BR:ali03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      AZOLI_2635 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2490099..2490692
Genome map
AA seq 197 aa AA seqDB search
MIGPEIERLIQLLSKLPGLGPRSARRAALHLMKRRDSLLVPLSEAMAAAGESIRACSVCG
NLDSRDPCTVCSDPTRDRSVICVVEDAGDLWALERTRAFRGTYHVLGGLLSALQGVGPDD
LNIAGLAERARDPAVREIILALNATVDGQTTAHVVTDRLTDSDVSVSRLAHGVPVGGELD
YLDDGTLTAALKARRPL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacctgaaatcgaacgcctgatccagttgctgtccaagctgccggggctcggt
ccccggtcggcgcggcgggcggcgctgcatctgatgaagcggcgggacagcctgctggtg
cccctgtcggaagcgatggcggcggccggcgaatcgatccgcgcctgctccgtctgcggc
aacctggacagccgcgatccctgcaccgtctgctccgaccccacccgcgaccgctcggtc
atctgcgtggtggaggatgccggcgatttgtgggcgctggaacgcacccgcgccttccgc
ggcacctaccatgtgctgggcggcctgctgtcggccctgcagggtgtcggccccgacgac
ctgaacatcgccggcctcgccgaacgcgccagggatccggcggttcgcgagatcatcctg
gcgctcaacgccaccgtcgacggccagaccaccgcccatgtggtgaccgaccgcctgacc
gactccgatgtgtccgtctcacgtctggcgcatggcgtccccgtcggcggtgagctggac
tatctcgacgacggcacgctgacggcggcgctgaaggcacggcggccgttgtag

DBGET integrated database retrieval system