KEGG   Azospirillum lipoferum: AZOLI_2795Help
Entry
AZOLI_2795        CDS       T01658                                 

Definition
Cytochrome C peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ali  Azospirillum lipoferum
Brite
Enzymes [BR:ali01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     AZOLI_2795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2634628..2635731)
Genome map
AA seq 367 aa AA seqDB search
MHAQSGHRPTAALKGLLVATAAALGILAATAGTAPAADPPAAGDALMGRARELFKPLPAT
LPAIRNNAVTREKIELGKMLFFDPRLSASGIFSCNSCHNLGLGGVDGLETSVGHGWQKGP
RNAPTVLNAVLNVAQFWDGRAEDLKAQAKGPIQAGVEMNSTPDRVMAVLNSIPTYKAKFA
DAFPNEKDPVTFDNVAMAIEAFEATLTTPAAPFDQYLEGKADALTDTQKAGLELFIDKGC
AGCHNGVNVGGHDYFPFGVVAKPGAEILPPGDKGRFAVTKTADDEYVFRAPTLRNVTLTA
PYFHSGKVWDLRQAVAVMGSSQLGATLSDQEIDKITAFLTTLTGQQPRVEYPLLPASTPA
TPQPVFK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcacaatccggacatcgtccgaccgcagcgctgaaaggcctgctggttgcgacc
gccgccgccctgggcatccttgccgcaaccgccggcacggcgccggccgccgacccccct
gcagccggcgacgccctgatgggccgtgcgcgcgaactgttcaagccgctgcccgccacc
ctgccggcgatccgcaacaatgcggtcacgcgcgagaagatcgaactcggcaagatgctg
ttcttcgatccgcgcctgtcggccagcggcatcttctcgtgcaacagctgccacaatctg
gggctcggcggcgtcgacgggctggagacctcggtcggtcatggctggcagaaggggccg
cgcaacgcgccgaccgtgctgaacgccgtgctgaacgtcgcccagttctgggacggccgg
gcggaagacctgaaggcccaggccaagggtccgatccaggccggcgtcgaaatgaacagc
acgcccgaccgtgtgatggccgtgctgaacagcatccccacctacaaggccaagttcgcc
gacgccttcccgaacgagaaggatccggtgaccttcgacaatgtcgccatggcgatcgag
gcgttcgaggcgacgctgaccaccccagccgcccccttcgaccagtatctggagggcaag
gccgacgcgctgaccgacacgcagaaggccgggctggagctgttcatcgacaagggctgc
gccggttgccacaacggcgtcaatgtcggcggccacgattacttccccttcggcgtggtg
gccaagccgggcgcggaaatcctgccgccgggcgacaagggccgcttcgccgtcaccaag
accgccgacgacgaatatgtcttccgcgcgcccaccctgcgcaacgtcacgctgaccgcc
ccctatttccattccggcaaggtgtgggatctgcgccaggcggtggcggtgatggggtcg
agccagctcggcgccaccctgtccgaccaggagatcgacaagatcaccgctttcctgacg
acgctgaccggccagcagccgcgcgtcgagtatccgctgctgccggccagcacgccggcc
acgccgcagcccgtgttcaagtaa

DBGET integrated database retrieval system