KEGG   Azospirillum lipoferum: AZOLI_2929Help
Entry
AZOLI_2929        CDS       T01658                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ali  Azospirillum lipoferum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AZOLI_2929 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AZOLI_2929 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AZOLI_2929 (trpA)
Enzymes [BR:ali01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AZOLI_2929 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2753744..2754589)
Genome map
AA seq 281 aa AA seqDB search
MKSADVGADGRIARRFNALKAEGRAGLVTFITAGDPDPAVSQSVLNGLPAAGADLIELGM
PFTDPMADGPAIQASSLRALKAGMTVHRTLEMVRGFRKQDADTPIILMGYFNPIHAYGVE
PFLADARAAGVDGLIVVDLPPEEDEELCIPAVEAGISFVRLTTPTTDEARMPMVMRNTSG
FVYYVSIAGITGTASASNTAIDAAVARLKRHTDLPVAVGFGIKTPDQAAEVARVADAAVV
GSAIVTRLADSLAAGVDGAAAVEDVLGFVGELAAGVRAARG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtgccgatgttggggccgatggccgcatcgcccgccggttcaatgcgctgaag
gcggagggacgcgccggtctggtcaccttcatcaccgccggcgatcccgatcccgccgtc
tcgcagtcggtgctgaacggcctgcccgccgctggcgccgacctgatcgagctgggcatg
cccttcaccgatccgatggccgacggcccggcgatccaggcctcctcgctgcgcgcactg
aaggccgggatgacggtgcacaggacgctggagatggtccgcggcttccgcaagcaggat
gccgacacgccgatcatcctgatgggctatttcaacccgatccacgcctatggggtggag
cccttcctggccgacgcgcgcgcggccggggtggacgggctgatcgtcgtcgacctgccg
ccggaagaggacgaggagctgtgcatcccggcggtggaggcgggcatcagcttcgtccgc
ctgaccacgccgaccaccgacgaggcgcgcatgcccatggtgatgcgcaacacctccggc
ttcgtctattacgtgtcgatcgccggcatcaccggcacagccagcgcatccaacaccgcc
attgacgcggcggtcgcccggctgaagcgccacaccgacctgccggtcgccgtcggcttc
ggcatcaagacgccggatcaggccgccgaggtcgcccgcgtcgccgatgccgccgtggtg
ggctcggccatcgtcacccgtctggccgacagcctggccgccggggtcgacggggcggcc
gctgtcgaggacgtgcttggcttcgtcggcgaactggccgccggggtgcgcgcggcgcgg
gggtga

DBGET integrated database retrieval system