KEGG   Azospirillum lipoferum: AZOLI_2929Help
Entry
AZOLI_2929        CDS       T01658                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ali  Azospirillum lipoferum
Pathway
ali00260  Glycine, serine and threonine metabolism
ali00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ali01100  Metabolic pathways
ali01110  Biosynthesis of secondary metabolites
ali01130  Biosynthesis of antibiotics
ali01230  Biosynthesis of amino acids
Module
ali_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AZOLI_2929 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AZOLI_2929 (trpA)
Enzymes [BR:ali01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AZOLI_2929 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: CBS88102
UniProt: G7Z3S1
Position
complement(2753744..2754589)
Genome map
AA seq 281 aa AA seqDB search
MKSADVGADGRIARRFNALKAEGRAGLVTFITAGDPDPAVSQSVLNGLPAAGADLIELGM
PFTDPMADGPAIQASSLRALKAGMTVHRTLEMVRGFRKQDADTPIILMGYFNPIHAYGVE
PFLADARAAGVDGLIVVDLPPEEDEELCIPAVEAGISFVRLTTPTTDEARMPMVMRNTSG
FVYYVSIAGITGTASASNTAIDAAVARLKRHTDLPVAVGFGIKTPDQAAEVARVADAAVV
GSAIVTRLADSLAAGVDGAAAVEDVLGFVGELAAGVRAARG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtgccgatgttggggccgatggccgcatcgcccgccggttcaatgcgctgaag
gcggagggacgcgccggtctggtcaccttcatcaccgccggcgatcccgatcccgccgtc
tcgcagtcggtgctgaacggcctgcccgccgctggcgccgacctgatcgagctgggcatg
cccttcaccgatccgatggccgacggcccggcgatccaggcctcctcgctgcgcgcactg
aaggccgggatgacggtgcacaggacgctggagatggtccgcggcttccgcaagcaggat
gccgacacgccgatcatcctgatgggctatttcaacccgatccacgcctatggggtggag
cccttcctggccgacgcgcgcgcggccggggtggacgggctgatcgtcgtcgacctgccg
ccggaagaggacgaggagctgtgcatcccggcggtggaggcgggcatcagcttcgtccgc
ctgaccacgccgaccaccgacgaggcgcgcatgcccatggtgatgcgcaacacctccggc
ttcgtctattacgtgtcgatcgccggcatcaccggcacagccagcgcatccaacaccgcc
attgacgcggcggtcgcccggctgaagcgccacaccgacctgccggtcgccgtcggcttc
ggcatcaagacgccggatcaggccgccgaggtcgcccgcgtcgccgatgccgccgtggtg
ggctcggccatcgtcacccgtctggccgacagcctggccgccggggtcgacggggcggcc
gctgtcgaggacgtgcttggcttcgtcggcgaactggccgccggggtgcgcgcggcgcgg
gggtga

DBGET integrated database retrieval system