KEGG   Azospirillum lipoferum: AZOLI_2930Help
Entry
AZOLI_2930        CDS       T01658                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ali  Azospirillum lipoferum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AZOLI_2930 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AZOLI_2930 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AZOLI_2930 (trpB)
Enzymes [BR:ali01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AZOLI_2930 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2754598..2755815)
Genome map
AA seq 405 aa AA seqDB search
MTKLNTYRSGPDERGHFGIFGGRFVAETLMPLILEVEKAYREARADPAFEGEMRQQLKQY
VGRPNPLYYAQRLTEQLGGAKIYFKREELNHTGAHKINNCIGQILLARRMGKTRIIAETG
AGQHGVATATVCALYDMPCVIYMGETDIARQQPNVFRMKLLGAEVRPVTSGSGTLKDAMN
EALRDWVTNVADTFYIIGTAAGPHPYPAMVRDFQSVIGDEVRTQMQELEGRLPDSLVACV
GGGSNAIGMFHPFLDDSSVQMIGVEAAGRGIEKGPLDHAASINGGRPGVLHGNRTYLLQD
EDGQILEGHSISAGLDYPGIGPEHSWLHDVGRVEYAYATDQEALDAFQLCARTEGIIPAL
ESAHGLAEVIKRAPKLPKDHLMVLCLSGRGDKDIFSVAKHLGVEL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaactgaacacctaccgctccggtcccgacgagcgcgggcatttcggaattttc
ggcggccgtttcgtcgccgagacgctgatgcccctgatcctggaggtcgagaaggcctat
cgcgaggcgcgggccgatcccgccttcgaaggcgagatgcgccagcagctgaagcagtat
gtcggccgccccaacccgctctattacgcccagcggctgaccgagcagctgggcggggcc
aagatctacttcaagcgcgaggagctgaaccacaccggcgcgcacaagatcaacaactgc
atcggtcagatcctgctggcccggcgcatgggcaagacccgcatcatcgccgagacgggc
gccggccagcatggcgtggcgaccgcgacggtctgcgcgctctacgacatgccctgcgtc
atctacatgggcgagaccgacatcgcccgccagcagcccaacgtcttccgcatgaagctg
ctgggggccgaggtgcgcccggtgacgtcgggcagcggcacgctgaaggacgcgatgaac
gaggcgctgcgcgactgggtcaccaacgtcgccgacaccttctacatcatcggcaccgcc
gccggcccgcacccctaccccgccatggtccgcgatttccagtcggtgatcggcgacgag
gtgcggacccagatgcaggaactggaaggccgcctgcccgacagcctggtcgcctgcgtc
ggcggcgggtcgaacgccatcggcatgttccacccgttcctggacgattcctcggtgcag
atgatcggcgtcgaggccgccggccgcggcatcgagaaggggccgctcgaccatgctgcc
tcgatcaacggcgggcgtccgggcgtgctgcacggcaaccgcacctatctgctgcaggac
gaggacggccagatcctggaaggccactcgatctccgctggcctcgactatcccggcatc
gggccggagcacagctggctgcatgacgtcggccgcgtcgaatacgcctatgccaccgac
caggaggcgctggacgccttccagctctgcgcccgcaccgagggcatcatcccggcgctg
gaatccgcccacggccttgccgaagtcatcaagcgcgcaccgaaactgcccaaggaccac
ctgatggtgctgtgcctgtcgggccgcggcgacaaggacatcttctccgtcgccaagcat
ctgggagtggaactgtga

DBGET integrated database retrieval system