KEGG   Azospirillum lipoferum 4B: AZOLI_3091Help
Entry
AZOLI_3091        CDS       T01658                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ali  Azospirillum lipoferum 4B
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ali00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2903909..2904583
Genome map
AA seq 224 aa AA seqDB search
MTATKTPHVNPPAVDNVLRGPGLSRPGAIVRPSRAEAEEAVRTLIRWAGDDPAREGLVGT
PDRVVRSYEEFFAGYGIDPVEILSRTFEETDGYDEMVILRDIRVESYCEHHMVPIIGKAH
VAYLPRRRVVGISKLARLVEAYGKRLQIQEKMTAQIANTIDEVLQPEGVAVVVEAQHQCM
TTRGVHKTGVTMVTSRMLGAFRTDPSTRREFLTMIGNPTSRGMD
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
gtgacggctaccaagaccccgcacgtcaaccccccggcggtcgacaatgtgcttcgcggc
cccggcctgtcccggcccggcgccatcgtccgtccgtcccgcgccgaggcggaggaagcc
gtgcggaccctgatccgttgggccggggacgatccggcgcgcgaaggtctggtcggcacg
cccgaccgcgtcgtccgctcctatgaggaattcttcgccggctacggcatcgacccggtg
gagatcctgtcgcgcaccttcgaggagaccgacggctacgacgagatggtcattctgcgc
gatatccgggtggagtcctattgcgagcaccacatggtgccgatcatcggcaaggcccat
gtcgcctatctgccgcgccgccgcgtcgtcggcatctccaagctggcgcgtctggtcgag
gcctatggcaagcgcctgcagatccaggagaagatgaccgcccagatcgccaacaccatc
gacgaggtcctgcagcccgagggcgtcgccgtcgtggtcgaggcgcagcaccagtgcatg
accacccgcggcgtgcacaagaccggcgtgaccatggtgaccagccgcatgctgggcgcc
ttccgcaccgacccctcgacccgccgcgaattcctgacgatgatcggcaacccgacctct
cgcgggatggactga

DBGET integrated database retrieval system