KEGG   Azospirillum lipoferum: AZOLI_3091Help
Entry
AZOLI_3091        CDS       T01658                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ali  Azospirillum lipoferum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AZOLI_3091 (folE)
Enzymes [BR:ali01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     AZOLI_3091 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2903909..2904583
Genome map
AA seq 224 aa AA seqDB search
MTATKTPHVNPPAVDNVLRGPGLSRPGAIVRPSRAEAEEAVRTLIRWAGDDPAREGLVGT
PDRVVRSYEEFFAGYGIDPVEILSRTFEETDGYDEMVILRDIRVESYCEHHMVPIIGKAH
VAYLPRRRVVGISKLARLVEAYGKRLQIQEKMTAQIANTIDEVLQPEGVAVVVEAQHQCM
TTRGVHKTGVTMVTSRMLGAFRTDPSTRREFLTMIGNPTSRGMD
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
gtgacggctaccaagaccccgcacgtcaaccccccggcggtcgacaatgtgcttcgcggc
cccggcctgtcccggcccggcgccatcgtccgtccgtcccgcgccgaggcggaggaagcc
gtgcggaccctgatccgttgggccggggacgatccggcgcgcgaaggtctggtcggcacg
cccgaccgcgtcgtccgctcctatgaggaattcttcgccggctacggcatcgacccggtg
gagatcctgtcgcgcaccttcgaggagaccgacggctacgacgagatggtcattctgcgc
gatatccgggtggagtcctattgcgagcaccacatggtgccgatcatcggcaaggcccat
gtcgcctatctgccgcgccgccgcgtcgtcggcatctccaagctggcgcgtctggtcgag
gcctatggcaagcgcctgcagatccaggagaagatgaccgcccagatcgccaacaccatc
gacgaggtcctgcagcccgagggcgtcgccgtcgtggtcgaggcgcagcaccagtgcatg
accacccgcggcgtgcacaagaccggcgtgaccatggtgaccagccgcatgctgggcgcc
ttccgcaccgacccctcgacccgccgcgaattcctgacgatgatcggcaacccgacctct
cgcgggatggactga

DBGET integrated database retrieval system