KEGG   Azospirillum lipoferum: AZOLI_3135Help
Entry
AZOLI_3135        CDS       T01658                                 

Gene name
pgx1
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ali  Azospirillum lipoferum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    AZOLI_3135 (pgx1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AZOLI_3135 (pgx1)
Enzymes [BR:ali01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AZOLI_3135 (pgx1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2940787..2941392)
Genome map
AA seq 201 aa AA seqDB search
MTVRTRFRTVALAAIPAALAAVFSVTGATSAMAASSATNAYSFTFQGIDGQPLPLSQFAG
KAILVVNTASQCGFTPQYKGLQALWQSYRDRGLVVVGVPSDDFGGQEPGSATQIKDFCEV
NYRIDFPMADKTVVSGDGAHPFYRWASDEMGFLAKPRWNFHKYLVGPDGKLVSWFSTMTD
PESDKVREAIEKLLPEKAPKS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtccgaacccgctttcgcaccgtggccttggccgccatccctgccgccctggcg
gctgtcttctccgtgacgggagccaccagcgccatggccgccagcagcgcaaccaacgcc
tacagcttcaccttccagggcatcgacgggcagccgctgccgctgtcgcagttcgcgggc
aaggcgatcctggtggtcaacaccgcgtcgcaatgcggtttcaccccgcaatacaaggga
ctgcaggcgctttggcagagctaccgcgaccgtgggctggtggtggtcggcgtgccgtcc
gacgacttcggcgggcaggagccggggagcgcgacccagatcaaggatttttgcgaggtc
aactatcggatcgacttcccgatggcggacaagacggtggtgtcgggcgacggcgcccac
cccttctaccgctgggcgtcggacgagatgggcttcctcgccaagccgcgctggaacttc
cacaaatatctggtcggtcccgacggcaagctggtgtcctggttctccaccatgaccgac
cccgaatcggacaaggtgcgcgaagcgatcgagaagctgctgccggagaaggcgccgaag
tcttaa

DBGET integrated database retrieval system