KEGG   Azospirillum lipoferum: AZOLI_3178Help
Entry
AZOLI_3178        CDS       T01658                                 

Gene name
paaF1
Definition
Enoyl-CoA hydratase-isomerase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ali  Azospirillum lipoferum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AZOLI_3178 (paaF1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AZOLI_3178 (paaF1)
   00650 Butanoate metabolism
    AZOLI_3178 (paaF1)
  Lipid metabolism
   00071 Fatty acid degradation
    AZOLI_3178 (paaF1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AZOLI_3178 (paaF1)
   00310 Lysine degradation
    AZOLI_3178 (paaF1)
   00360 Phenylalanine metabolism
    AZOLI_3178 (paaF1)
   00380 Tryptophan metabolism
    AZOLI_3178 (paaF1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AZOLI_3178 (paaF1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AZOLI_3178 (paaF1)
   00281 Geraniol degradation
    AZOLI_3178 (paaF1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AZOLI_3178 (paaF1)
   00627 Aminobenzoate degradation
    AZOLI_3178 (paaF1)
   00930 Caprolactam degradation
    AZOLI_3178 (paaF1)
Enzymes [BR:ali01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AZOLI_3178 (paaF1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2987263..2988039
Genome map
AA seq 258 aa AA seqDB search
MSYETILVETRGPVGLITLNRPKALNALCDQLVTELGQALDDFEADQAIGAIVVTGSERA
FAAGADIKEMAGFSYMDVYNSNFITAKWERLAKCRKPTIAAVAGFALGGGCELAMMADFI
LAADTAKFGQPEVTIGTIPGAGGTQRLTRFVGKSKAMEMVLTGRMIDAAEAERCGLVSRI
VPAAELVEEAVKVATKIASLSQPVIAMAKEAVNVAYESTLAEGIRFERRLFHSTFATEDQ
KEGMAAFAEKRQAGWKNR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtcctatgaaaccattctcgtcgagacccgcggcccggtcggcctgatcacgctcaac
cgtccgaaggcgctgaatgcgctgtgcgaccagctggtgaccgagctgggtcaggccctg
gacgatttcgaggccgatcaagccatcggcgccatcgtcgtcaccgggtcggagcgcgcc
ttcgccgccggcgccgacatcaaggagatggccggcttctcttatatggatgtctacaat
tccaacttcatcaccgcgaagtgggagcggctggccaagtgccgcaagccgaccatcgcc
gcggtcgccggcttcgcgctgggcggcggttgcgagctggcgatgatggccgacttcatc
ctggccgccgacaccgccaagttcggccagccggaggtcaccatcggcaccatccccggc
gccggcggcacccagcgcctgacccgcttcgtcggcaagtccaaggcgatggagatggtc
ctgaccggccgcatgatcgacgccgccgaggccgagcgctgcggcctcgtctcccgcatc
gtcccggccgccgagctggtggaggaggcggtgaaggtcgccaccaagatcgcctcgctg
tcgcagccggtcatcgccatggccaaggaggcggtcaacgtcgcctatgagtcgacgctg
gccgagggcatccgtttcgagcgccgcctgttccattcgaccttcgccaccgaagaccag
aaggaaggcatggccgccttcgccgagaagcgccaggccggctggaagaaccgctga

DBGET integrated database retrieval system