KEGG   Azospirillum lipoferum: AZOLI_p10107Help
Entry
AZOLI_p10107      CDS       T01658                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ali  Azospirillum lipoferum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AZOLI_p10107 (malQ)
Enzymes [BR:ali01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     AZOLI_p10107 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZO_p1:116143..118332
Genome map
AA seq 729 aa AA seqDB search
MSDLDRLADLLGVEPLYHDIWGNRRETSAATKRALVAAMGLPTATDEEVAASLRTVERRS
WSRPLPPVLVTGEGQGIGLGVALPAGLDDATLVWELTPEGASAQGGRVTVRDLPVEQRAM
LDGTAYERRALGGLLPVSLPIGYHRLAVHVEAPGGAGPSGATTLIVAPDRCVTVEEMVPA
GRCWGIGLQVYSLRSDRDWGMGDFGDLSGFAEVAGRLGAGLVGLNPLHALFPADPNHIGP
YSPSSRQFLNILYIDPSSVPELADADDLRARIADPAFQSALAAARQAELVDYPAVAALKL
PVLEELHARFRNLPDDHPRKAAYARFRQKMGVALDRHALFDALHEHFFRKDPSLWMWRSW
PAAFQDPGSAEVAAFAADHADRVDFFTWAQFEADRQLGEAAARGTSAGLAMGFYRDLAVA
AHPGGGSAWADPSMLVQGANVGAPPDQFNLKGQNWGLAPLSPLGLREAAYRPFVELLRAN
MRHAAALRIDHVMALQHLFWIPEDGSDGAYVAYPFHDLLRIVALESRRNRCVVIGEDLGT
VPEGFRPALEQAGILSYRVLYFERTADGGFKPPGDYPAGSMATVSTHDLAPFKGFWTGRD
LDWRQRLSLYPDDASRDKDRWDRGVDRWRLLQALSREGLRPDSYPTEDGDQPFRIELSAA
VHAYLARTPSRIVMVQIEDALADDEQPNLPGTVDQHPNWRRRLPCKLEELEADDDLRRIL
APMTNIALR
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatctcgaccggctggccgatctgcttggggtagaacccctctaccatgacatc
tggggcaaccggcgcgagacctccgccgccaccaagcgggcgctggtcgccgccatgggg
ctgccgacggccacggacgaggaggtcgccgccagcctgcgcacggtggagcggcgatcc
tggagccgcccgttgccgccggtcttggtcaccggggaagggcagggcatcgggctgggc
gtcgccctgccggccggcctggacgatgccacgctggtatgggaactgacgccggagggg
gcgagcgcccagggtggccgcgtcacggtccgcgacctgccggtggagcagcgcgccatg
ctggacggcacggcctatgagcgccgcgcgctcggcggcctgctgccggtgtcgctgccc
atcggttaccaccggctggccgtgcatgtggaggcccctggcggcgccggtccatccggt
gccaccaccctgatcgtggcgcccgaccgttgcgtgacagtggaggagatggtgccggcc
ggccgctgctggggcatcgggttgcaggtctattccctgcggtccgaccgcgattggggc
atgggggatttcggcgatctttccggctttgccgaggtcgccggccggctgggcgccggg
ctggtcgggctgaacccgctgcatgccctgttcccggccgacccgaaccatatcggcccc
tattcgccgtccagccgccaattcctcaacatcctctacatcgacccgtcctccgttccc
gagctggcggacgccgacgacctgcgtgcccggatcgcggaccccgccttccagtccgcg
ctggccgcggcgcggcaggcggagctggtcgattaccccgcggtcgccgcactgaagctt
ccggtgctggaggaactgcacgcgcgcttccgcaacctgcccgacgaccacccgcgcaag
gctgcctatgcccgcttccggcagaagatgggggtggcgcttgaccgccatgccctgttc
gatgccctgcacgagcatttcttccgcaaggacccgtcgctgtggatgtggcgcagctgg
cccgcggccttccaggatccggggagcgccgaggtcgccgccttcgccgcagaccatgca
gaccgcgtcgatttcttcacctgggcgcagttcgaggccgaccgccagttgggcgaggcg
gcggcgcgcggcacgtccgcaggccttgccatgggcttctaccgcgacctcgccgtggcc
gcccatcccggcggcggttccgcctgggccgatccgtcgatgctggttcagggcgccaat
gtcggcgctccgcccgaccagttcaatctgaagggccagaactggggcttggcgccgctg
tcgccgctgggcctgcgcgaggccgcctaccgccccttcgtcgaactcctgcgggccaac
atgcgccatgcggcggcgcttcgcatcgaccatgtgatggcgttgcagcacctgttctgg
attccggaggacggcagcgacggcgcctatgtcgcctatcccttccacgaccttctgcgc
atcgtggcgctggagagccgccgcaaccgttgcgtcgtgatcggcgaggatcttggcacc
gttccggagggcttccggccggcattggagcaggccgggatcctcagctaccgcgtgctg
tatttcgaacgcactgccgacggcggcttcaagcctcccggcgattatcccgccggttcc
atggcgacggtcagcacgcatgatctggcacccttcaagggcttctggaccggccgagac
ctcgactggcgccagcgtctcagcctctatcccgacgatgccagccgggacaaggaccgc
tgggaccgcggcgtcgaccgctggcgcctgttgcaggccctgtcccgcgaggggctgcgc
ccggacagctatccgaccgaggacggcgaccagcccttccgcatcgaactgtccgctgct
gtccacgcctatctggcgcgtaccccgtcccgcatcgtgatggtgcagatcgaggacgcg
ctggcggacgacgagcagcccaatcttcccggcaccgtcgaccagcatccgaactggcgt
cgccgccttccttgcaagctggaggagttggaggccgacgacgatctccgacggatcctc
gccccgatgacaaacatagcgttgcgctga

DBGET integrated database retrieval system