KEGG   Azospirillum lipoferum 4B: AZOLI_p10413Help
Entry
AZOLI_p10413      CDS       T01658                                 

Gene name
glmS
Definition
glucosamine--fructose-6-phosphate aminotransferase
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
ali  Azospirillum lipoferum 4B
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ali00520]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ali00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZO_p1:complement(411796..413622)
Genome map
AA seq 608 aa AA seqDB search
MCGIIGINGIHDASPRLVEGLRRLEYRGYDSAGVATLVNGHIERRRAEGKLSNLDMKLRD
QPLSGTVGIGHTRWATHGGPTENNAHPHATKRVAVVHNGIIENYQELKDELTGHGYVFES
ATDTEVIVHLVTYYLDQQGMTPVQASAAAFKRFTGAFALVLIFAGEHELMIGARHGTPLA
VGYGDGEMYLASDAFALAPLTNRICYLEDGDWVEVSRAATIVHDASDAVVDRPVKTTAVS
GALIGKDGYRHYMLKEIYEQPQVIGDTLNAYINPETGTFTLPDFPFDLAGASKLTIVACG
TAYYAGFVAKYWFETLARIPVEVDIASEFRYREAPLPPGGIALFISQSGETLDTLEALRY
CKRQGQKILSIVNAPESTIARESDAVLYTMAGPEIGVASTKAFTTQLTTLACLAVTVGRA
RGAIDQERMQQIAHALREVPARAADVLAHDERLKELAQEVSEARDVLYLGRGAMYPLALE
GALKLKEISYIHAEGYAAGELKHGPIALIDDNVPVIVLVPSDALFEKVVSNVQEVCARSG
KVLLLADRKGIDKLKDKVRWSVELPACDPLVAPLLYAIPVQLLAYHTAVLKGTDVDQPRN
LAKSVTVE
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatcatcggcatcaacggcatccacgacgcgtccccccggctggtggaaggc
ctgcgccggctcgaataccgcggctatgacagcgcgggcgtcgccaccctggtgaacggc
catatcgagcgccgccgcgcagagggcaagctgagcaacctggacatgaagctgcgcgac
cagccgctgtccggtacggtcggcatcggccacacccgctgggccacccatggcggcccg
accgagaacaacgcccatccgcacgcgaccaagcgcgtcgccgtcgttcacaacggcatc
atcgagaattaccaggagctgaaggacgagctgaccggccacggctatgtcttcgaaagc
gccaccgacaccgaggtgatcgtccacctcgtcacctattacctggaccagcagggcatg
acgccggtccaggcgtcggccgccgccttcaagcgcttcaccggcgccttcgccctggtg
ctgatcttcgccggcgagcatgagctgatgatcggcgcccgccacggcacgccgctggcc
gtcggctatggcgacggcgagatgtatctggcctccgacgcgttcgccctggcgccgctg
accaaccgcatctgttatctggaggatggcgactgggtcgaggtcagccgcgccgccacc
atcgtccatgacgccagcgacgcggtggtcgaccgtccggtgaagaccaccgcggtgtcc
ggcgccctgatcggcaaggacggctaccgccattacatgctcaaggaaatctacgagcag
ccgcaggtcatcggcgacacgctgaacgcctacatcaacccggaaaccggcactttcact
ctgccggacttccccttcgatctggccggcgcgtcaaagctgaccatcgtcgcctgcggc
accgcctattacgccggtttcgtcgccaaatactggttcgagacgctggcccgcatcccg
gtcgaagtcgacatcgcctcggagttccgttaccgcgaggcgccgctgccgccgggcggc
atcgcgctgttcatctcgcagtcgggcgagacgctggatacgctggaggcgctgcgttac
tgcaagcgtcagggccagaaaatcctgtcgatcgtgaatgcgccggaaagcaccatcgcg
cgggaatccgacgcggtgctctacaccatggcggggccggagatcggcgtcgcctcgacc
aaggccttcaccacccagctgaccacgctggcctgccttgccgtcaccgtcggccgcgcc
cgcggcgccatcgaccaggagcggatgcagcagatcgcccacgccctgcgcgaggtcccg
gcccgtgccgccgatgtcctggcccatgacgagcggctgaaggaactggcgcaggaggtg
tcggaagcccgcgacgtgctgtatctcggccgcggcgccatgtatccgctggccctggaa
ggcgcgctgaagctgaaggaaatcagctacatccatgccgagggttatgctgccggcgaa
ctgaagcacggccccatcgccctgatcgacgacaatgtgccggtgatcgtgctggtgccg
tcagacgcgctgttcgagaaggtggtgtcgaacgtgcaggaggtctgcgcccgctccggc
aaggtcctgctgctggccgacaggaagggcatcgacaagctgaaggacaaggtccgctgg
tcggtggagctcccggcctgcgacccgctggtggcgccgctgctgtatgccattccggtg
cagcttcttgcctatcacacggcagtactgaaggggacggacgtcgatcagccgcggaac
ttggcaaagtcagtgaccgtcgagtaa

DBGET integrated database retrieval system