KEGG   Azospirillum lipoferum: AZOLI_p10490Help
Entry
AZOLI_p10490      CDS       T01658                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ali  Azospirillum lipoferum
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ali00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AZOLI_p10490 (deoA)
Enzymes [BR:ali01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     AZOLI_p10490 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AZO_p1:complement(474192..475511)
Genome map
AA seq 439 aa AA seqDB search
MLPQEIVRAKRDGQPLDAATIQDFVRGITDGRVSESQAAAFAMAVFFRGMSLDERVALTR
AMRDSGTVMEWKSLGLPGPVIDKHSTGGVGDKVSLILAPMLAACGGFVPMVSGRGLGHTG
GTLDKFESIPGYRAKPDNELLRQVVKEVGCAVIGATDDIAPADKRLYAIRDVTATVESLD
LITASILSKKLAAGLDALVMDVKFGTGAFMQRFEDAEALADSIVTVSMGAGLPAVALLTD
MNEVLGRSAGNALEMRECLAILRGEAADPRLYEVTAALAADLLALAGLAPDAAAGRVMAD
RSIASGAAAERFARMVAALGGPADLLEQPDRHLESAPIVRPVFAERAGFVGAIDTRGVGM
AVVALGGGRTKTTDAIDFAVGFDDVAGLGDAVGPGERPLAILHARTEAQAEEAERRLKAS
VTVTDAAPERGPLIAKRLG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcttccacaagagatcgtccgcgccaagcgcgacggccagccgctcgacgccgccacc
atccaggacttcgtccgcggcatcaccgacggccgcgtttcggaatcccaggccgcggcc
ttcgccatggccgtcttcttccgcggcatgagcctggacgagcgggtggcgctgacccgc
gcaatgcgcgattccggcacggtgatggagtggaagtcgctgggcctgcccggcccggtg
atcgacaagcattccaccggcggcgtcggcgacaaggtcagcctgatcctggcgccgatg
ctggccgcctgcggcggattcgtgccgatggtgtcgggccgcggccttggccacaccggc
ggcacgctcgacaagttcgagagcatccccggctaccgcgccaagccagacaacgagctg
ctgcgccaggtggtgaaggaggtcggctgcgcggtgatcggcgccaccgacgacatcgcc
ccggccgacaagcgcctttacgccatccgcgacgtgacggcgacggtggagtcgctcgac
ctcatcaccgcgtcgatcctgtcgaagaagctcgccgccgggctggacgcgctggtgatg
gacgtgaagttcggcaccggcgccttcatgcagcgattcgaggatgccgaggcgctggcg
gacagcatcgtcaccgtgtcgatgggcgccggcctgccggcggtcgccctgctgaccgac
atgaacgaggtgctgggccgcagcgccggcaacgcgctggagatgcgcgaatgcctcgcc
atcctgcgcggcgaggcggccgacccgcggctctatgaagtgacggcggcgctggcagcg
gatctgctggcgcttgccgggctggcgccggacgccgcggcgggacgggtcatggccgac
cgctccatcgccagcggcgcggcagcggagcgcttcgcccgcatggtggcggcgctgggc
ggaccggccgatttgctggagcagccggaccgccatctggaaagcgcgcccatcgtccgc
ccggtcttcgccgagcgcgccggcttcgtcggcgccatcgacacccgcggagtcggcatg
gcggtggtggcgctgggaggtggccggaccaagaccaccgacgccatcgacttcgccgtc
ggcttcgacgacgtcgccgggctgggcgacgcggtgggtcccggagagcggccgctggcg
atcctgcacgcccgcacggaggcgcaggccgaggaggcggaacgccgcctgaaggcgtcg
gtcacggtgacggacgccgcaccggagcgggggccgctgatcgctaagcgtctggggtga

DBGET integrated database retrieval system